Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YK08

Protein Details
Accession G8YK08    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-32KQRAANAKWAKKNIKKQGKPRSKDEEHydrophilic
NLS Segment(s)
PositionSequence
10-28AANAKWAKKNIKKQGKPRS
Subcellular Location(s) mito 13, E.R. 4, plas 3, cyto 2, golg 2, nucl 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MGTQTPKQRAANAKWAKKNIKKQGKPRSKDEETEYPVSRVWLAALLFLVCGGIILELIRMVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.75
4 0.75
5 0.8
6 0.8
7 0.81
8 0.8
9 0.84
10 0.86
11 0.87
12 0.83
13 0.8
14 0.79
15 0.71
16 0.66
17 0.62
18 0.59
19 0.53
20 0.53
21 0.46
22 0.37
23 0.34
24 0.3
25 0.24
26 0.16
27 0.12
28 0.1
29 0.09
30 0.08
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04