Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YHW0

Protein Details
Accession G8YHW0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-128FEAYRECKRDFFRKRKEDRIKGKGGWBasic
NLS Segment(s)
PositionSequence
115-125RKRKEDRIKGK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MTEVSESKGREPEKQEKAENDNKDKAVNSSKNENDFKERVNFTKGGIENLKFYPDDPKNHHHKYNWTLKEPSKFYDPCEESRQASLNCILRNQEDRSVCTEYFEAYRECKRDFFRKRKEDRIKGKGGWGFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.59
4 0.65
5 0.67
6 0.67
7 0.64
8 0.61
9 0.56
10 0.52
11 0.47
12 0.43
13 0.45
14 0.42
15 0.39
16 0.42
17 0.45
18 0.5
19 0.53
20 0.51
21 0.48
22 0.44
23 0.42
24 0.41
25 0.39
26 0.34
27 0.36
28 0.33
29 0.27
30 0.33
31 0.31
32 0.28
33 0.29
34 0.27
35 0.25
36 0.25
37 0.26
38 0.18
39 0.18
40 0.22
41 0.23
42 0.27
43 0.3
44 0.36
45 0.44
46 0.48
47 0.52
48 0.45
49 0.48
50 0.5
51 0.55
52 0.53
53 0.48
54 0.48
55 0.47
56 0.52
57 0.47
58 0.41
59 0.38
60 0.34
61 0.32
62 0.38
63 0.36
64 0.34
65 0.38
66 0.38
67 0.32
68 0.34
69 0.36
70 0.26
71 0.26
72 0.27
73 0.25
74 0.23
75 0.23
76 0.23
77 0.21
78 0.26
79 0.27
80 0.29
81 0.27
82 0.28
83 0.32
84 0.35
85 0.32
86 0.29
87 0.27
88 0.22
89 0.21
90 0.21
91 0.18
92 0.18
93 0.24
94 0.26
95 0.27
96 0.31
97 0.36
98 0.45
99 0.54
100 0.61
101 0.66
102 0.73
103 0.8
104 0.86
105 0.91
106 0.91
107 0.91
108 0.9
109 0.87
110 0.79
111 0.79