Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YEK7

Protein Details
Accession G8YEK7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
142-164MILRAAPKKKHSRSRRRMKLYAPHydrophilic
NLS Segment(s)
PositionSequence
146-161AAPKKKHSRSRRRMKL
Subcellular Location(s) nucl 18.5, cyto_nucl 13.833, mito_nucl 10.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSSEKEFFHLSSSGSKTPLTGFIRNTYRREKGFMSVVSILSRDAGIIQGLRASMYTTANRISSMPMVPASGSSSSKLLVAVQGAIESLGQLPGYFGIPGISIKVRNATGMTNTAEVDERLEELREQIENNGGKPPFMFDNGMILRAAPKKKHSRSRRRMKLYAPGDKKISPLENLVRCPACGKVKRSHFMCMHCFAEIRTFLKGKKKDLQEPAVEPQADLDPVDQNILYPGKYEREYERRLKKKDWIPVREEPLDFNPKQVKPDIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.26
4 0.26
5 0.33
6 0.31
7 0.31
8 0.31
9 0.38
10 0.47
11 0.52
12 0.56
13 0.55
14 0.57
15 0.54
16 0.56
17 0.51
18 0.47
19 0.48
20 0.43
21 0.4
22 0.36
23 0.34
24 0.3
25 0.28
26 0.22
27 0.16
28 0.15
29 0.09
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.09
41 0.11
42 0.12
43 0.13
44 0.15
45 0.16
46 0.16
47 0.16
48 0.16
49 0.15
50 0.15
51 0.14
52 0.13
53 0.13
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.12
60 0.12
61 0.12
62 0.12
63 0.12
64 0.1
65 0.08
66 0.08
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.04
83 0.04
84 0.05
85 0.05
86 0.07
87 0.07
88 0.08
89 0.08
90 0.11
91 0.11
92 0.11
93 0.12
94 0.11
95 0.11
96 0.13
97 0.14
98 0.12
99 0.12
100 0.12
101 0.12
102 0.11
103 0.1
104 0.07
105 0.07
106 0.07
107 0.07
108 0.06
109 0.07
110 0.08
111 0.07
112 0.07
113 0.07
114 0.12
115 0.12
116 0.13
117 0.17
118 0.16
119 0.15
120 0.15
121 0.16
122 0.11
123 0.13
124 0.13
125 0.08
126 0.14
127 0.15
128 0.15
129 0.14
130 0.13
131 0.14
132 0.19
133 0.21
134 0.17
135 0.25
136 0.34
137 0.43
138 0.53
139 0.61
140 0.68
141 0.76
142 0.85
143 0.89
144 0.88
145 0.85
146 0.79
147 0.78
148 0.75
149 0.74
150 0.67
151 0.6
152 0.54
153 0.49
154 0.46
155 0.39
156 0.33
157 0.24
158 0.24
159 0.28
160 0.29
161 0.29
162 0.32
163 0.29
164 0.27
165 0.27
166 0.27
167 0.28
168 0.3
169 0.34
170 0.39
171 0.46
172 0.53
173 0.55
174 0.58
175 0.55
176 0.55
177 0.55
178 0.5
179 0.44
180 0.37
181 0.35
182 0.27
183 0.28
184 0.24
185 0.21
186 0.2
187 0.21
188 0.24
189 0.33
190 0.38
191 0.39
192 0.45
193 0.5
194 0.56
195 0.62
196 0.65
197 0.61
198 0.61
199 0.59
200 0.57
201 0.5
202 0.41
203 0.34
204 0.28
205 0.23
206 0.19
207 0.15
208 0.11
209 0.11
210 0.12
211 0.11
212 0.09
213 0.12
214 0.13
215 0.12
216 0.12
217 0.14
218 0.17
219 0.19
220 0.22
221 0.27
222 0.35
223 0.42
224 0.51
225 0.59
226 0.64
227 0.69
228 0.72
229 0.73
230 0.73
231 0.76
232 0.76
233 0.74
234 0.72
235 0.74
236 0.76
237 0.72
238 0.65
239 0.59
240 0.56
241 0.57
242 0.49
243 0.47
244 0.48
245 0.44
246 0.48
247 0.51