Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y8H5

Protein Details
Accession G8Y8H5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-55DINFKSTLPPRKRAKTKEEKEQRRVERILRNRRAAHASREKKRRHVEFBasic
NLS Segment(s)
PositionSequence
16-51PPRKRAKTKEEKEQRRVERILRNRRAAHASREKKRR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR044280  Hac1/HY5  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006986  P:response to unfolded protein  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MTESDSLDINFKSTLPPRKRAKTKEEKEQRRVERILRNRRAAHASREKKRRHVEFLESYVMKLESNLDRLQKNFDIVGSKVDPTVLKGLRLSKLDDLSSLKEQIHSNLGSVSLEPETKRRRTMTDDSPERESSVEKESSAESALATGDESGCDVQVKVEYDDSEDFSLSNTNSNDNVYFNYLSPISINSPVNSPIDLTLKKSDEEVTPLSLGGEESVREDEGLGQNSEEILLPRGYEEMSTVVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.48
4 0.56
5 0.66
6 0.76
7 0.79
8 0.82
9 0.83
10 0.85
11 0.87
12 0.88
13 0.88
14 0.87
15 0.89
16 0.85
17 0.82
18 0.79
19 0.76
20 0.75
21 0.75
22 0.77
23 0.75
24 0.76
25 0.71
26 0.71
27 0.72
28 0.65
29 0.65
30 0.65
31 0.66
32 0.67
33 0.74
34 0.74
35 0.76
36 0.81
37 0.78
38 0.76
39 0.72
40 0.71
41 0.68
42 0.67
43 0.64
44 0.54
45 0.47
46 0.4
47 0.34
48 0.25
49 0.18
50 0.18
51 0.13
52 0.16
53 0.19
54 0.21
55 0.22
56 0.23
57 0.28
58 0.25
59 0.25
60 0.21
61 0.2
62 0.19
63 0.18
64 0.21
65 0.17
66 0.16
67 0.15
68 0.15
69 0.14
70 0.13
71 0.19
72 0.16
73 0.15
74 0.17
75 0.21
76 0.23
77 0.24
78 0.25
79 0.21
80 0.22
81 0.21
82 0.21
83 0.2
84 0.2
85 0.2
86 0.19
87 0.16
88 0.17
89 0.18
90 0.17
91 0.19
92 0.15
93 0.14
94 0.13
95 0.13
96 0.1
97 0.1
98 0.09
99 0.06
100 0.07
101 0.07
102 0.14
103 0.19
104 0.21
105 0.25
106 0.25
107 0.27
108 0.33
109 0.39
110 0.41
111 0.46
112 0.49
113 0.48
114 0.51
115 0.48
116 0.41
117 0.35
118 0.27
119 0.2
120 0.18
121 0.16
122 0.13
123 0.13
124 0.13
125 0.13
126 0.13
127 0.11
128 0.06
129 0.06
130 0.06
131 0.05
132 0.05
133 0.04
134 0.04
135 0.03
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.07
143 0.09
144 0.09
145 0.1
146 0.1
147 0.13
148 0.14
149 0.15
150 0.13
151 0.12
152 0.11
153 0.1
154 0.12
155 0.1
156 0.13
157 0.12
158 0.13
159 0.13
160 0.15
161 0.15
162 0.14
163 0.15
164 0.15
165 0.15
166 0.13
167 0.15
168 0.14
169 0.13
170 0.13
171 0.13
172 0.12
173 0.16
174 0.17
175 0.16
176 0.17
177 0.19
178 0.2
179 0.18
180 0.16
181 0.14
182 0.19
183 0.19
184 0.21
185 0.25
186 0.25
187 0.26
188 0.26
189 0.26
190 0.22
191 0.26
192 0.24
193 0.21
194 0.19
195 0.19
196 0.18
197 0.16
198 0.14
199 0.1
200 0.09
201 0.07
202 0.09
203 0.1
204 0.1
205 0.1
206 0.1
207 0.13
208 0.18
209 0.2
210 0.19
211 0.17
212 0.17
213 0.17
214 0.18
215 0.14
216 0.11
217 0.11
218 0.1
219 0.1
220 0.11
221 0.12
222 0.11
223 0.11
224 0.11
225 0.1