Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M8A326

Protein Details
Accession A0A1M8A326    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
148-168AAPIPGRRERSPPRRGRRYRSBasic
NLS Segment(s)
PositionSequence
153-168GRRERSPPRRGRRYRS
Subcellular Location(s) nucl 14, cyto 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MSSRASEIEEDAAPFLLRCAVTRSEFRHLDDFQSKTLRGELNVYAWPTTTLREVANLLYLVDPTLSRPMTTHDFRVVYFDGDRGRYEADRPVYGVTRIPTAAVASLLASKEGSLDASQKASAAEQAASRTLQQLRVRDDTVLECALDAAPIPGRRERSPPRRGRRYRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.11
4 0.1
5 0.1
6 0.14
7 0.17
8 0.21
9 0.27
10 0.31
11 0.36
12 0.39
13 0.41
14 0.42
15 0.4
16 0.43
17 0.44
18 0.4
19 0.36
20 0.38
21 0.35
22 0.3
23 0.33
24 0.27
25 0.22
26 0.23
27 0.21
28 0.19
29 0.21
30 0.21
31 0.17
32 0.16
33 0.17
34 0.14
35 0.14
36 0.13
37 0.12
38 0.11
39 0.12
40 0.13
41 0.11
42 0.13
43 0.11
44 0.1
45 0.09
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.1
52 0.09
53 0.09
54 0.1
55 0.13
56 0.19
57 0.21
58 0.21
59 0.21
60 0.22
61 0.22
62 0.25
63 0.21
64 0.17
65 0.15
66 0.15
67 0.13
68 0.13
69 0.14
70 0.11
71 0.11
72 0.1
73 0.11
74 0.14
75 0.15
76 0.14
77 0.14
78 0.15
79 0.15
80 0.15
81 0.16
82 0.12
83 0.11
84 0.11
85 0.11
86 0.09
87 0.09
88 0.08
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.08
102 0.08
103 0.1
104 0.1
105 0.1
106 0.1
107 0.09
108 0.1
109 0.09
110 0.09
111 0.09
112 0.11
113 0.12
114 0.12
115 0.12
116 0.15
117 0.16
118 0.22
119 0.26
120 0.3
121 0.34
122 0.38
123 0.39
124 0.35
125 0.35
126 0.3
127 0.29
128 0.24
129 0.18
130 0.14
131 0.13
132 0.12
133 0.1
134 0.09
135 0.07
136 0.11
137 0.14
138 0.17
139 0.22
140 0.27
141 0.3
142 0.39
143 0.49
144 0.54
145 0.62
146 0.7
147 0.76
148 0.83