Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M7ZZU0

Protein Details
Accession A0A1M7ZZU0   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
247-273ALKAKDIPLPPRNQRRKLKVYLPTCHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006840  ChaC  
IPR013024  GGCT-like  
Gene Ontology GO:0003839  F:gamma-glutamylcyclotransferase activity  
GO:0061928  F:glutathione specific gamma-glutamylcyclotransferase activity  
GO:0016740  F:transferase activity  
GO:0006751  P:glutathione catabolic process  
Pfam View protein in Pfam  
PF04752  ChaC  
CDD cd06661  GGCT_like  
Amino Acid Sequences MKSAQRDYPDILHSYKQNPTLVLEPHTQHEDRLQKIHEILPHLRDLPTNAKRPPGSFDIFGYGSIIFKPPPHVISYTPGYIQGFVRRFALHSEDHRGTPERPGRVVTLVSADHWHSLPGADDAPEGDIVWGISYTIDPAHADEVRAYLDNREKIGYTPMWAPIFGYHGMSEEPQVLVPEALVYVGLPDHEAFVGPQPLDELAERIHTCHGPSGPNHEYLLRLAEAVRILTPKSKDIHLFSLEEKVLALKAKDIPLPPRNQRRKLKVYLPTCHDQSDKLLCSIFVHQRKISSRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.41
4 0.39
5 0.36
6 0.37
7 0.37
8 0.36
9 0.35
10 0.35
11 0.31
12 0.33
13 0.38
14 0.35
15 0.3
16 0.35
17 0.38
18 0.36
19 0.4
20 0.39
21 0.36
22 0.38
23 0.41
24 0.36
25 0.36
26 0.36
27 0.34
28 0.35
29 0.33
30 0.31
31 0.28
32 0.29
33 0.33
34 0.37
35 0.41
36 0.39
37 0.45
38 0.46
39 0.47
40 0.48
41 0.44
42 0.4
43 0.34
44 0.34
45 0.31
46 0.3
47 0.28
48 0.24
49 0.18
50 0.14
51 0.13
52 0.13
53 0.09
54 0.09
55 0.14
56 0.15
57 0.16
58 0.19
59 0.2
60 0.2
61 0.25
62 0.28
63 0.25
64 0.23
65 0.23
66 0.21
67 0.2
68 0.2
69 0.22
70 0.2
71 0.2
72 0.21
73 0.2
74 0.2
75 0.2
76 0.23
77 0.19
78 0.2
79 0.27
80 0.27
81 0.27
82 0.29
83 0.3
84 0.27
85 0.33
86 0.35
87 0.3
88 0.29
89 0.3
90 0.29
91 0.28
92 0.27
93 0.19
94 0.16
95 0.13
96 0.13
97 0.13
98 0.12
99 0.11
100 0.11
101 0.11
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.05
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.04
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.08
132 0.08
133 0.08
134 0.09
135 0.13
136 0.14
137 0.14
138 0.15
139 0.14
140 0.14
141 0.17
142 0.15
143 0.13
144 0.13
145 0.15
146 0.15
147 0.14
148 0.14
149 0.11
150 0.13
151 0.12
152 0.11
153 0.08
154 0.08
155 0.09
156 0.09
157 0.09
158 0.07
159 0.07
160 0.06
161 0.07
162 0.06
163 0.06
164 0.05
165 0.05
166 0.04
167 0.04
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.07
180 0.09
181 0.09
182 0.09
183 0.09
184 0.09
185 0.1
186 0.1
187 0.09
188 0.07
189 0.11
190 0.12
191 0.12
192 0.14
193 0.14
194 0.14
195 0.17
196 0.18
197 0.17
198 0.18
199 0.26
200 0.26
201 0.27
202 0.27
203 0.24
204 0.24
205 0.21
206 0.23
207 0.15
208 0.13
209 0.11
210 0.12
211 0.12
212 0.11
213 0.12
214 0.1
215 0.11
216 0.16
217 0.17
218 0.19
219 0.21
220 0.24
221 0.27
222 0.3
223 0.35
224 0.33
225 0.33
226 0.31
227 0.35
228 0.31
229 0.27
230 0.23
231 0.18
232 0.16
233 0.16
234 0.15
235 0.13
236 0.17
237 0.19
238 0.23
239 0.26
240 0.33
241 0.39
242 0.47
243 0.54
244 0.61
245 0.69
246 0.75
247 0.82
248 0.83
249 0.85
250 0.85
251 0.84
252 0.82
253 0.81
254 0.8
255 0.77
256 0.74
257 0.67
258 0.62
259 0.54
260 0.46
261 0.44
262 0.44
263 0.39
264 0.34
265 0.32
266 0.28
267 0.3
268 0.35
269 0.39
270 0.37
271 0.41
272 0.41
273 0.48
274 0.53