Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5E7M7

Protein Details
Accession M5E7M7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAQRLTLRKRNPYNTRSNRRRVIKTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG msym:MSY001_0786  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRLTLRKRNPYNTRSNRRRVIKTPSGQLRYLHLKKLPTAPKCGDCHAALQGVKALRPRAYATVSKREKTVQRAYGGSRCAACVRTRVVRAFLVEESKIVKNVIRAQQAKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.86
4 0.86
5 0.85
6 0.84
7 0.84
8 0.8
9 0.79
10 0.77
11 0.73
12 0.74
13 0.74
14 0.69
15 0.63
16 0.57
17 0.53
18 0.53
19 0.5
20 0.45
21 0.39
22 0.36
23 0.36
24 0.44
25 0.47
26 0.4
27 0.44
28 0.43
29 0.46
30 0.46
31 0.46
32 0.4
33 0.32
34 0.31
35 0.26
36 0.25
37 0.19
38 0.17
39 0.17
40 0.14
41 0.14
42 0.15
43 0.15
44 0.12
45 0.13
46 0.15
47 0.15
48 0.18
49 0.23
50 0.25
51 0.34
52 0.37
53 0.37
54 0.37
55 0.39
56 0.41
57 0.43
58 0.47
59 0.41
60 0.41
61 0.42
62 0.45
63 0.44
64 0.41
65 0.35
66 0.27
67 0.23
68 0.22
69 0.21
70 0.19
71 0.18
72 0.22
73 0.26
74 0.3
75 0.31
76 0.33
77 0.32
78 0.33
79 0.32
80 0.29
81 0.27
82 0.23
83 0.22
84 0.22
85 0.22
86 0.21
87 0.19
88 0.19
89 0.2
90 0.29
91 0.35
92 0.41
93 0.42