Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YEF4

Protein Details
Accession G8YEF4   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-100EDLKKNDFMKWRKKQINKANTAKIKNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 6.5, cyto_nucl 5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLHLFKGAVSPVLRAPVRQFTSVSILSNEVKSSCKAGTVLNLKIRKSGDEPVALEDHEYPEWLWDCLNKEKVDEDLKKNDFMKWRKKQINKANTAKIKNNNFLSTLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.3
4 0.33
5 0.33
6 0.32
7 0.28
8 0.33
9 0.33
10 0.3
11 0.22
12 0.21
13 0.21
14 0.21
15 0.19
16 0.14
17 0.15
18 0.14
19 0.15
20 0.13
21 0.12
22 0.13
23 0.13
24 0.19
25 0.22
26 0.26
27 0.3
28 0.34
29 0.33
30 0.35
31 0.35
32 0.3
33 0.28
34 0.28
35 0.23
36 0.23
37 0.23
38 0.21
39 0.22
40 0.19
41 0.17
42 0.13
43 0.12
44 0.09
45 0.09
46 0.07
47 0.08
48 0.09
49 0.08
50 0.08
51 0.09
52 0.13
53 0.18
54 0.22
55 0.21
56 0.21
57 0.22
58 0.26
59 0.32
60 0.34
61 0.33
62 0.38
63 0.4
64 0.43
65 0.43
66 0.44
67 0.44
68 0.47
69 0.53
70 0.54
71 0.63
72 0.69
73 0.76
74 0.83
75 0.84
76 0.87
77 0.86
78 0.85
79 0.85
80 0.84
81 0.82
82 0.8
83 0.78
84 0.75
85 0.74
86 0.7
87 0.62