Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YIH2

Protein Details
Accession A0A1Q2YIH2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-34ATDPGILLKRRKDRQKANERLQLRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10, mito 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
Amino Acid Sequences MPPAKRGSLATDPGILLKRRKDRQKANERLQLRLDEQGVKRTEVENNLSFSSIPQVLLINQKNYYTEYLKKDENLRIVRNTREKLNKKLKVKAPSATTKRGDLDRVKNGSASVSVTASANVTENENDDDDDDGDDDGDDAADDGEGRTLVIHPGSHNIKIGWAEDVDPVLVPNLIGYIRREVSEGTPGATAANSKRPAHSVSGLDPPRYLARGDGEPVNEGEEEDENDDGDRFYVLNGDKEFRAKRMFQFQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.37
5 0.45
6 0.52
7 0.62
8 0.69
9 0.74
10 0.82
11 0.87
12 0.89
13 0.89
14 0.89
15 0.81
16 0.75
17 0.69
18 0.62
19 0.53
20 0.46
21 0.39
22 0.38
23 0.37
24 0.4
25 0.37
26 0.34
27 0.34
28 0.31
29 0.33
30 0.3
31 0.34
32 0.3
33 0.31
34 0.3
35 0.29
36 0.27
37 0.23
38 0.22
39 0.17
40 0.14
41 0.11
42 0.12
43 0.13
44 0.21
45 0.24
46 0.23
47 0.23
48 0.23
49 0.24
50 0.25
51 0.27
52 0.23
53 0.27
54 0.29
55 0.32
56 0.34
57 0.35
58 0.39
59 0.4
60 0.44
61 0.43
62 0.41
63 0.43
64 0.46
65 0.5
66 0.52
67 0.5
68 0.49
69 0.54
70 0.56
71 0.6
72 0.67
73 0.68
74 0.66
75 0.72
76 0.72
77 0.7
78 0.68
79 0.63
80 0.59
81 0.61
82 0.6
83 0.58
84 0.53
85 0.47
86 0.45
87 0.41
88 0.4
89 0.37
90 0.38
91 0.39
92 0.4
93 0.38
94 0.36
95 0.34
96 0.29
97 0.23
98 0.17
99 0.1
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.06
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.03
125 0.03
126 0.02
127 0.03
128 0.02
129 0.03
130 0.02
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.05
138 0.06
139 0.06
140 0.12
141 0.14
142 0.14
143 0.15
144 0.14
145 0.15
146 0.16
147 0.16
148 0.12
149 0.1
150 0.1
151 0.09
152 0.1
153 0.08
154 0.07
155 0.07
156 0.06
157 0.06
158 0.04
159 0.04
160 0.04
161 0.05
162 0.06
163 0.07
164 0.11
165 0.12
166 0.13
167 0.13
168 0.14
169 0.15
170 0.2
171 0.18
172 0.16
173 0.15
174 0.15
175 0.14
176 0.13
177 0.14
178 0.11
179 0.18
180 0.22
181 0.23
182 0.25
183 0.27
184 0.3
185 0.32
186 0.34
187 0.29
188 0.27
189 0.36
190 0.37
191 0.35
192 0.32
193 0.31
194 0.29
195 0.27
196 0.24
197 0.16
198 0.18
199 0.2
200 0.22
201 0.23
202 0.22
203 0.22
204 0.22
205 0.21
206 0.17
207 0.15
208 0.14
209 0.12
210 0.12
211 0.12
212 0.12
213 0.11
214 0.11
215 0.12
216 0.1
217 0.09
218 0.08
219 0.06
220 0.06
221 0.12
222 0.13
223 0.18
224 0.2
225 0.23
226 0.24
227 0.32
228 0.34
229 0.33
230 0.38
231 0.38
232 0.42