Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B4X1

Protein Details
Accession G3B4X1   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-103RMNMVISRKKRNKGAPKKKSSHydrophilic
NLS Segment(s)
PositionSequence
90-103RKKRNKGAPKKKSS
Subcellular Location(s) mito 21, nucl 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG cten:CANTEDRAFT_98009  -  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVVLKKLPTKERLLQAKKLSAEIFGEIWNPQSVRNGAKILRAPLKGPEVVKYYGTNDSMPTFKDFKEWFPELKLVDPREEIRMNMVISRKKRNKGAPKKKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.68
3 0.66
4 0.67
5 0.61
6 0.56
7 0.47
8 0.38
9 0.33
10 0.26
11 0.21
12 0.15
13 0.15
14 0.12
15 0.13
16 0.13
17 0.12
18 0.11
19 0.14
20 0.15
21 0.16
22 0.18
23 0.2
24 0.19
25 0.23
26 0.24
27 0.25
28 0.29
29 0.27
30 0.26
31 0.26
32 0.27
33 0.25
34 0.24
35 0.22
36 0.2
37 0.2
38 0.21
39 0.18
40 0.18
41 0.18
42 0.19
43 0.16
44 0.14
45 0.14
46 0.14
47 0.14
48 0.15
49 0.14
50 0.13
51 0.19
52 0.19
53 0.2
54 0.27
55 0.28
56 0.26
57 0.27
58 0.3
59 0.25
60 0.3
61 0.33
62 0.27
63 0.27
64 0.29
65 0.28
66 0.3
67 0.3
68 0.25
69 0.23
70 0.25
71 0.23
72 0.24
73 0.29
74 0.3
75 0.35
76 0.46
77 0.51
78 0.55
79 0.63
80 0.7
81 0.76
82 0.8
83 0.86