Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YF53

Protein Details
Accession G8YF53   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MATSVPRTKIVKKHHKKFKRHQSDRFMRVGEHydrophilic
NLS Segment(s)
PositionSequence
9-25KIVKKHHKKFKRHQSDR
Subcellular Location(s) mito 15.5, mito_nucl 12.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MATSVPRTKIVKKHHKKFKRHQSDRFMRVGESWRKPKGIDSCVRRRFRGTISMPKIGYGSNKKTRHVIPSGHKVFVVNNIKDLDVLLMHTKSYAAEIAHNVSARNRVEIVSKAKKLGVKVTNPKGRVSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.9
4 0.93
5 0.93
6 0.93
7 0.92
8 0.92
9 0.92
10 0.92
11 0.87
12 0.81
13 0.71
14 0.6
15 0.53
16 0.52
17 0.5
18 0.48
19 0.48
20 0.46
21 0.46
22 0.46
23 0.5
24 0.49
25 0.48
26 0.48
27 0.49
28 0.57
29 0.65
30 0.68
31 0.63
32 0.59
33 0.54
34 0.49
35 0.5
36 0.45
37 0.46
38 0.47
39 0.51
40 0.47
41 0.44
42 0.41
43 0.32
44 0.31
45 0.27
46 0.3
47 0.35
48 0.37
49 0.38
50 0.41
51 0.43
52 0.42
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.34
63 0.35
64 0.25
65 0.25
66 0.25
67 0.25
68 0.24
69 0.24
70 0.15
71 0.08
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.08
80 0.09
81 0.07
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.15
88 0.15
89 0.21
90 0.2
91 0.2
92 0.18
93 0.17
94 0.2
95 0.25
96 0.33
97 0.36
98 0.37
99 0.37
100 0.39
101 0.41
102 0.41
103 0.44
104 0.43
105 0.44
106 0.52
107 0.61
108 0.66
109 0.65
110 0.64
111 0.59