Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YG37

Protein Details
Accession A0A1Q2YG37   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-31APQLNPKIVKKHTKKFKRHHSDRYHRVGESBasic
NLS Segment(s)
PositionSequence
11-20KKHTKKFKRH
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAPQLNPKIVKKHTKKFKRHHSDRYHRVGESWRLQKGIDSCVRRRFRGTISAPKIGYGSNKKTKFLRPDGKKAFVVSNLKDLEVLLLHTQTYAAEIAHNVSAKNRVEILARAKAIGVKVTNPKGRVTLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.88
4 0.91
5 0.91
6 0.92
7 0.92
8 0.92
9 0.93
10 0.92
11 0.9
12 0.84
13 0.72
14 0.65
15 0.61
16 0.57
17 0.55
18 0.51
19 0.43
20 0.39
21 0.39
22 0.4
23 0.35
24 0.35
25 0.33
26 0.33
27 0.36
28 0.46
29 0.49
30 0.47
31 0.49
32 0.45
33 0.41
34 0.45
35 0.46
36 0.46
37 0.48
38 0.51
39 0.47
40 0.44
41 0.41
42 0.32
43 0.32
44 0.27
45 0.3
46 0.34
47 0.35
48 0.37
49 0.4
50 0.45
51 0.47
52 0.5
53 0.53
54 0.5
55 0.59
56 0.62
57 0.63
58 0.58
59 0.52
60 0.44
61 0.4
62 0.38
63 0.29
64 0.29
65 0.26
66 0.25
67 0.23
68 0.22
69 0.16
70 0.12
71 0.12
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.06
80 0.05
81 0.05
82 0.06
83 0.07
84 0.09
85 0.1
86 0.09
87 0.1
88 0.17
89 0.17
90 0.19
91 0.18
92 0.17
93 0.19
94 0.23
95 0.28
96 0.28
97 0.28
98 0.26
99 0.26
100 0.27
101 0.26
102 0.26
103 0.21
104 0.2
105 0.29
106 0.37
107 0.42
108 0.42
109 0.43
110 0.43