Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YBJ0

Protein Details
Accession A0A1Q2YBJ0    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-32DSEKPVRRTLRRKSTNLETTKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10cyto_nucl 10, cyto 8, mito 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR002717  HAT_MYST-type  
Gene Ontology GO:0004402  F:histone acetyltransferase activity  
GO:0016573  P:histone acetylation  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS51726  MYST_HAT  
Amino Acid Sequences MNNEEMVTFNEDSEKPVRRTLRRKSTNLETTKTGGTKAGETGDDEYGFLDYQNVAKLRLGRYEFNTWYGNSALFTKPIQNRATNKLNTKLAFKEDPQNVQRSPTKKSTKSAVEVNPCSFEIRDKEPWIDTLFVCPFCFKYTDIQMEWEHHMNCCKFKFNLPGKVMYNDGQLIVRKVKGVDQKLFCQSTGAVAWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.36
4 0.45
5 0.5
6 0.6
7 0.67
8 0.73
9 0.75
10 0.78
11 0.79
12 0.8
13 0.8
14 0.76
15 0.69
16 0.61
17 0.55
18 0.53
19 0.46
20 0.37
21 0.3
22 0.25
23 0.22
24 0.21
25 0.19
26 0.15
27 0.16
28 0.18
29 0.17
30 0.16
31 0.14
32 0.13
33 0.12
34 0.11
35 0.09
36 0.07
37 0.06
38 0.07
39 0.11
40 0.11
41 0.11
42 0.13
43 0.17
44 0.18
45 0.24
46 0.26
47 0.25
48 0.29
49 0.35
50 0.34
51 0.34
52 0.34
53 0.27
54 0.26
55 0.24
56 0.19
57 0.14
58 0.15
59 0.12
60 0.12
61 0.12
62 0.17
63 0.19
64 0.25
65 0.27
66 0.3
67 0.33
68 0.39
69 0.46
70 0.44
71 0.45
72 0.44
73 0.46
74 0.41
75 0.4
76 0.35
77 0.31
78 0.29
79 0.27
80 0.29
81 0.27
82 0.32
83 0.31
84 0.33
85 0.29
86 0.31
87 0.35
88 0.29
89 0.32
90 0.35
91 0.41
92 0.41
93 0.43
94 0.46
95 0.46
96 0.47
97 0.49
98 0.45
99 0.45
100 0.45
101 0.43
102 0.38
103 0.34
104 0.31
105 0.25
106 0.21
107 0.17
108 0.2
109 0.23
110 0.23
111 0.25
112 0.24
113 0.26
114 0.25
115 0.23
116 0.18
117 0.19
118 0.19
119 0.19
120 0.18
121 0.17
122 0.16
123 0.16
124 0.17
125 0.13
126 0.16
127 0.21
128 0.26
129 0.26
130 0.29
131 0.29
132 0.3
133 0.33
134 0.32
135 0.27
136 0.23
137 0.29
138 0.28
139 0.31
140 0.3
141 0.32
142 0.29
143 0.34
144 0.43
145 0.45
146 0.53
147 0.5
148 0.55
149 0.53
150 0.54
151 0.51
152 0.42
153 0.36
154 0.27
155 0.25
156 0.21
157 0.2
158 0.21
159 0.22
160 0.21
161 0.2
162 0.2
163 0.26
164 0.32
165 0.38
166 0.43
167 0.45
168 0.5
169 0.57
170 0.58
171 0.51
172 0.44
173 0.37
174 0.32