Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q2YIY5

Protein Details
Accession A0A1Q2YIY5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-40AMAGGKKSKKKWSKGKVKDKASHLVHydrophilic
NLS Segment(s)
PositionSequence
11-35AKAAAAMAGGKKSKKKWSKGKVKDK
Subcellular Location(s) mito 13.5, mito_nucl 11.833, nucl 9, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKIQQSKAAKAAAAMAGGKKSKKKWSKGKVKDKASHLVILDQEKYDRILKEVPTYRFVSISVLVDRLKIGGSLARVALRQLEEDGVIKPVSKHSKQLIYTRAIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.14
5 0.16
6 0.19
7 0.22
8 0.25
9 0.29
10 0.39
11 0.47
12 0.55
13 0.63
14 0.71
15 0.79
16 0.84
17 0.9
18 0.89
19 0.9
20 0.87
21 0.81
22 0.78
23 0.68
24 0.6
25 0.49
26 0.42
27 0.34
28 0.3
29 0.25
30 0.18
31 0.16
32 0.13
33 0.15
34 0.15
35 0.13
36 0.13
37 0.15
38 0.16
39 0.22
40 0.28
41 0.28
42 0.29
43 0.31
44 0.29
45 0.26
46 0.25
47 0.2
48 0.15
49 0.15
50 0.12
51 0.12
52 0.12
53 0.12
54 0.11
55 0.1
56 0.09
57 0.07
58 0.06
59 0.07
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.13
67 0.12
68 0.12
69 0.11
70 0.11
71 0.11
72 0.12
73 0.13
74 0.12
75 0.11
76 0.11
77 0.11
78 0.19
79 0.27
80 0.28
81 0.34
82 0.39
83 0.48
84 0.52
85 0.59
86 0.57