Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q2YEN3

Protein Details
Accession A0A1Q2YEN3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-55PDYIAKQRERKEAKNKSRSSRDFSHydrophilic
114-134GENELKRRARRREEEPKKINABasic
NLS Segment(s)
PositionSequence
119-130KRRARRREEEPK
Subcellular Location(s) cyto 8, cyto_nucl 8, nucl 6, E.R. 5, pero 3, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MFLILLVVMVVMVAVTIMLPQLSGLTTYTNNPDYIAKQRERKEAKNKSRSSRDFSGQQQQNAFSYAAPDAEIEGEDQAVSSKSSAFRGVRSTLSKLAHPQLTESDIPIKLELVGENELKRRARRREEEPKKINADPNNFDYDIDEFIDEENRKEVLESQQDAQRRYGMSDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.05
11 0.06
12 0.08
13 0.09
14 0.11
15 0.16
16 0.17
17 0.17
18 0.17
19 0.19
20 0.2
21 0.27
22 0.33
23 0.35
24 0.42
25 0.47
26 0.56
27 0.61
28 0.67
29 0.7
30 0.73
31 0.78
32 0.81
33 0.82
34 0.82
35 0.85
36 0.81
37 0.78
38 0.72
39 0.66
40 0.61
41 0.59
42 0.6
43 0.54
44 0.51
45 0.45
46 0.4
47 0.36
48 0.33
49 0.28
50 0.17
51 0.14
52 0.12
53 0.1
54 0.09
55 0.08
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.07
71 0.11
72 0.12
73 0.12
74 0.15
75 0.17
76 0.19
77 0.21
78 0.22
79 0.23
80 0.24
81 0.24
82 0.24
83 0.26
84 0.24
85 0.22
86 0.21
87 0.17
88 0.2
89 0.19
90 0.17
91 0.16
92 0.15
93 0.15
94 0.14
95 0.13
96 0.1
97 0.1
98 0.09
99 0.08
100 0.1
101 0.11
102 0.13
103 0.15
104 0.19
105 0.22
106 0.27
107 0.34
108 0.41
109 0.49
110 0.55
111 0.62
112 0.7
113 0.77
114 0.83
115 0.8
116 0.79
117 0.74
118 0.71
119 0.68
120 0.63
121 0.6
122 0.54
123 0.51
124 0.49
125 0.44
126 0.4
127 0.35
128 0.29
129 0.23
130 0.19
131 0.16
132 0.1
133 0.11
134 0.17
135 0.16
136 0.16
137 0.17
138 0.16
139 0.16
140 0.17
141 0.2
142 0.21
143 0.28
144 0.3
145 0.32
146 0.36
147 0.41
148 0.42
149 0.41
150 0.37
151 0.3