Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YGN4

Protein Details
Accession A0A1Q2YGN4   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
92-112EAEASPEPSQKKKKNKKKGKKBasic
NLS Segment(s)
PositionSequence
100-112SQKKKKNKKKGKK
Subcellular Location(s) nucl 18, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MKIKQIDTKDDDKIRSIIRFKTYDPKSGICHVFKTHKVKEFSKLFNALGPRGCNVDGQDVEGLSLLFSNTDKDSIIKEVSEPVPSNEKIKAEAEASPEPSQKKKKNKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.43
4 0.4
5 0.41
6 0.42
7 0.41
8 0.48
9 0.47
10 0.48
11 0.47
12 0.44
13 0.42
14 0.46
15 0.49
16 0.4
17 0.4
18 0.37
19 0.39
20 0.43
21 0.48
22 0.47
23 0.49
24 0.52
25 0.51
26 0.56
27 0.56
28 0.53
29 0.49
30 0.46
31 0.38
32 0.36
33 0.35
34 0.28
35 0.24
36 0.21
37 0.17
38 0.16
39 0.16
40 0.14
41 0.13
42 0.15
43 0.12
44 0.12
45 0.12
46 0.1
47 0.1
48 0.09
49 0.08
50 0.04
51 0.04
52 0.03
53 0.03
54 0.04
55 0.05
56 0.06
57 0.06
58 0.07
59 0.07
60 0.09
61 0.11
62 0.12
63 0.1
64 0.11
65 0.15
66 0.15
67 0.18
68 0.18
69 0.18
70 0.23
71 0.24
72 0.26
73 0.24
74 0.24
75 0.24
76 0.24
77 0.23
78 0.19
79 0.21
80 0.24
81 0.25
82 0.29
83 0.29
84 0.32
85 0.34
86 0.41
87 0.49
88 0.52
89 0.6
90 0.67
91 0.75
92 0.82