Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YFV2

Protein Details
Accession G8YFV2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-88ENKFHQFKKIRSKKSEMKASGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015898  G-protein_gamma-like_dom  
IPR036284  GGL_sf  
IPR041848  Ste18_fungal  
Gene Ontology GO:0031681  F:G-protein beta-subunit binding  
GO:0007186  P:G protein-coupled receptor signaling pathway  
GO:0000750  P:pheromone-dependent signal transduction involved in conjugation with cellular fusion  
Pfam View protein in Pfam  
PF00631  G-gamma  
Amino Acid Sequences MTSIRQEEITNRIAEVKLKRILELNTRLRDTLNRERIRASDASLLIIDYVQKTPDYIISDMWTLPTEENKFHQFKKIRSKKSEMKASGCCSIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.29
4 0.31
5 0.31
6 0.32
7 0.33
8 0.35
9 0.38
10 0.43
11 0.45
12 0.44
13 0.44
14 0.44
15 0.41
16 0.41
17 0.41
18 0.43
19 0.45
20 0.42
21 0.42
22 0.43
23 0.42
24 0.43
25 0.35
26 0.27
27 0.21
28 0.18
29 0.18
30 0.17
31 0.16
32 0.12
33 0.11
34 0.09
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.09
42 0.11
43 0.11
44 0.11
45 0.12
46 0.13
47 0.13
48 0.13
49 0.11
50 0.09
51 0.09
52 0.14
53 0.14
54 0.15
55 0.19
56 0.25
57 0.28
58 0.29
59 0.38
60 0.39
61 0.46
62 0.56
63 0.63
64 0.66
65 0.7
66 0.78
67 0.78
68 0.82
69 0.84
70 0.79
71 0.76
72 0.74
73 0.71