Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YBR0

Protein Details
Accession A0A1Q2YBR0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-106HSRIVRVRSRTNRKIRAPPVRQRFNQNHydrophilic
NLS Segment(s)
PositionSequence
91-99NRKIRAPPV
Subcellular Location(s) mito 13.5, mito_nucl 12.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKSGRGHVKPVRCVNCSRCVPKDKAIKRMTVRNMVEAAAVRDISEASVYDEYPIPKMFNKLHYCVSCAIHSRIVRVRSRTNRKIRAPPVRQRFNQNAKRVSPADAAKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.69
3 0.69
4 0.65
5 0.65
6 0.71
7 0.75
8 0.71
9 0.64
10 0.64
11 0.59
12 0.62
13 0.61
14 0.59
15 0.56
16 0.57
17 0.58
18 0.59
19 0.65
20 0.61
21 0.63
22 0.61
23 0.61
24 0.59
25 0.63
26 0.6
27 0.59
28 0.54
29 0.46
30 0.44
31 0.36
32 0.33
33 0.24
34 0.2
35 0.12
36 0.11
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.07
47 0.09
48 0.09
49 0.1
50 0.1
51 0.09
52 0.1
53 0.14
54 0.15
55 0.22
56 0.26
57 0.27
58 0.33
59 0.33
60 0.34
61 0.33
62 0.33
63 0.27
64 0.27
65 0.26
66 0.26
67 0.26
68 0.28
69 0.31
70 0.34
71 0.37
72 0.38
73 0.46
74 0.51
75 0.61
76 0.67
77 0.72
78 0.76
79 0.79
80 0.84
81 0.84
82 0.85
83 0.84
84 0.84
85 0.85
86 0.85
87 0.81
88 0.79
89 0.8
90 0.79
91 0.79
92 0.77
93 0.74
94 0.67
95 0.7
96 0.63
97 0.58
98 0.54
99 0.52