Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q2YEL9

Protein Details
Accession A0A1Q2YEL9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-27FSQTGEKARRRERYRYKRIGSKLPAHydrophilic
NLS Segment(s)
PositionSequence
10-21ARRRERYRYKRI
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MLFSQTGEKARRRERYRYKRIGSKLPAGAQEVARKYRLFGAYGTQADRRGGLQQGVEGADDGKVLEGSFKTASAGRVQELPGGGAKLQREAAQRFGAGAVREDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.85
4 0.86
5 0.86
6 0.84
7 0.85
8 0.84
9 0.78
10 0.75
11 0.69
12 0.61
13 0.55
14 0.49
15 0.44
16 0.36
17 0.36
18 0.32
19 0.29
20 0.27
21 0.25
22 0.23
23 0.27
24 0.26
25 0.21
26 0.18
27 0.19
28 0.22
29 0.23
30 0.24
31 0.19
32 0.19
33 0.18
34 0.18
35 0.15
36 0.12
37 0.12
38 0.11
39 0.1
40 0.09
41 0.09
42 0.09
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.03
52 0.05
53 0.05
54 0.07
55 0.07
56 0.08
57 0.09
58 0.1
59 0.11
60 0.13
61 0.15
62 0.13
63 0.15
64 0.15
65 0.16
66 0.15
67 0.15
68 0.13
69 0.13
70 0.12
71 0.13
72 0.13
73 0.14
74 0.15
75 0.18
76 0.23
77 0.25
78 0.29
79 0.29
80 0.28
81 0.26
82 0.27
83 0.26
84 0.21