Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YDU7

Protein Details
Accession A0A1Q2YDU7   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
95-116YGTRVANKLRKRNSASNRSISHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 16.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR046925  WD-like_fungi  
Pfam View protein in Pfam  
PF20493  WD-like_fungi  
Amino Acid Sequences MEDMLINALENDLLGDAFLLYHKIIFNGQAATTAPTENSNMSQEMAILLNYSNSSGCALRFSDLATMSSSAELSDFYYTLGNSTVLSTLSYDDVYGTRVANKLRKRNSASNRSISH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.07
9 0.07
10 0.08
11 0.08
12 0.1
13 0.11
14 0.11
15 0.11
16 0.11
17 0.12
18 0.13
19 0.13
20 0.12
21 0.11
22 0.1
23 0.12
24 0.11
25 0.12
26 0.11
27 0.11
28 0.11
29 0.11
30 0.1
31 0.09
32 0.09
33 0.07
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.1
52 0.09
53 0.1
54 0.09
55 0.09
56 0.09
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.08
74 0.07
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.09
82 0.1
83 0.09
84 0.11
85 0.14
86 0.19
87 0.27
88 0.35
89 0.44
90 0.51
91 0.6
92 0.66
93 0.73
94 0.79
95 0.82
96 0.81