Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YJ70

Protein Details
Accession A0A1Q2YJ70    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
285-304LLPVDKKKKRASKAASGDVKHydrophilic
NLS Segment(s)
PositionSequence
290-297KKKKRASK
327-333KKSKKKL
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVEEAEDEDNADEDDEDDEDEEDEEDEVDEEEVDEVDEVDEVDEVDEVDEVDEEVEETEEVEEEEAEEIDELEAMDETEGVVEVLVVDELDKLDSEETYSAAEIVTDPNFVPSPEKPFNFLIDYEISFKEDKTAGVIDDLYNGETVELAYNFQSLEPSEVSIVGVGGELLDPVTGVSLANITASQIGPIPVENNQVVNFTQRVGINMAPRKYLLVPAIYIVYQDQFMLLGSTNKLVNIVDPKISLFNPQLLVAELILGATFAGLVYFVYNAFAGKYLAGVLPESLLPVDKKKKRASKAASGDVKEQATASKADYESWLPDSHKNLTKKSKKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.09
9 0.08
10 0.08
11 0.08
12 0.07
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.05
50 0.05
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.06
90 0.05
91 0.07
92 0.07
93 0.07
94 0.07
95 0.09
96 0.09
97 0.09
98 0.12
99 0.12
100 0.2
101 0.24
102 0.25
103 0.27
104 0.28
105 0.3
106 0.29
107 0.27
108 0.22
109 0.18
110 0.19
111 0.18
112 0.17
113 0.16
114 0.15
115 0.14
116 0.14
117 0.13
118 0.12
119 0.11
120 0.11
121 0.1
122 0.1
123 0.11
124 0.08
125 0.09
126 0.09
127 0.08
128 0.07
129 0.07
130 0.06
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.06
141 0.05
142 0.07
143 0.06
144 0.07
145 0.07
146 0.07
147 0.07
148 0.06
149 0.06
150 0.04
151 0.03
152 0.03
153 0.03
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.04
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.07
178 0.09
179 0.09
180 0.1
181 0.1
182 0.11
183 0.11
184 0.12
185 0.11
186 0.09
187 0.12
188 0.11
189 0.12
190 0.13
191 0.15
192 0.19
193 0.24
194 0.24
195 0.22
196 0.22
197 0.23
198 0.21
199 0.22
200 0.17
201 0.13
202 0.13
203 0.13
204 0.13
205 0.12
206 0.11
207 0.09
208 0.08
209 0.07
210 0.06
211 0.06
212 0.05
213 0.05
214 0.05
215 0.06
216 0.07
217 0.07
218 0.09
219 0.09
220 0.09
221 0.09
222 0.09
223 0.11
224 0.14
225 0.15
226 0.14
227 0.15
228 0.16
229 0.17
230 0.18
231 0.19
232 0.15
233 0.17
234 0.17
235 0.17
236 0.17
237 0.15
238 0.15
239 0.12
240 0.11
241 0.07
242 0.06
243 0.05
244 0.05
245 0.03
246 0.03
247 0.03
248 0.02
249 0.02
250 0.02
251 0.02
252 0.03
253 0.04
254 0.04
255 0.05
256 0.05
257 0.05
258 0.06
259 0.07
260 0.07
261 0.06
262 0.07
263 0.07
264 0.08
265 0.08
266 0.08
267 0.07
268 0.08
269 0.08
270 0.08
271 0.07
272 0.09
273 0.1
274 0.18
275 0.28
276 0.33
277 0.42
278 0.52
279 0.61
280 0.67
281 0.76
282 0.76
283 0.77
284 0.8
285 0.82
286 0.8
287 0.73
288 0.69
289 0.63
290 0.55
291 0.45
292 0.36
293 0.27
294 0.21
295 0.2
296 0.17
297 0.19
298 0.19
299 0.19
300 0.22
301 0.23
302 0.24
303 0.25
304 0.27
305 0.24
306 0.29
307 0.32
308 0.37
309 0.43
310 0.46
311 0.52
312 0.6
313 0.68