Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YIA7

Protein Details
Accession A0A1Q2YIA7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-74STDRVVKPKKLVRQPRKAEKNNCPPKPKPHydrophilic
NLS Segment(s)
PositionSequence
53-64PKKLVRQPRKAE
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MAITRSRNAPKKVAGDIVAPSSKLHNAEETVATSSCNLNVDKTESSTDRVVKPKKLVRQPRKAEKNNCPPKPKPGDEDLPNWRDMKTGSDIIKSEIFRSAKSEKAEMAQKYKKILKYGNIRAPKLSDDKTLKKVLGEIVDKNKELIFWDYFSKRLQAEGYGNAVFLENECRLQAHEVTSTQRDNLIKQKEQKEGSQAEVKTERGVEDAKDALGKYTKINLMKAAVDTDLQKLLQEVSNNSEKYSAVNEENAFSGLKLVDFTTIRNFNNEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.4
4 0.39
5 0.33
6 0.28
7 0.25
8 0.23
9 0.24
10 0.23
11 0.22
12 0.2
13 0.2
14 0.22
15 0.23
16 0.23
17 0.22
18 0.2
19 0.19
20 0.17
21 0.16
22 0.15
23 0.16
24 0.14
25 0.13
26 0.15
27 0.19
28 0.19
29 0.2
30 0.24
31 0.23
32 0.26
33 0.29
34 0.31
35 0.32
36 0.4
37 0.44
38 0.45
39 0.52
40 0.56
41 0.61
42 0.67
43 0.73
44 0.74
45 0.79
46 0.84
47 0.86
48 0.9
49 0.9
50 0.9
51 0.89
52 0.9
53 0.89
54 0.87
55 0.84
56 0.76
57 0.77
58 0.76
59 0.7
60 0.64
61 0.6
62 0.6
63 0.56
64 0.6
65 0.58
66 0.51
67 0.48
68 0.43
69 0.36
70 0.29
71 0.26
72 0.23
73 0.19
74 0.22
75 0.21
76 0.23
77 0.24
78 0.25
79 0.29
80 0.25
81 0.22
82 0.23
83 0.22
84 0.2
85 0.24
86 0.25
87 0.25
88 0.26
89 0.27
90 0.21
91 0.24
92 0.3
93 0.27
94 0.33
95 0.33
96 0.33
97 0.37
98 0.41
99 0.4
100 0.38
101 0.4
102 0.39
103 0.44
104 0.51
105 0.54
106 0.55
107 0.53
108 0.49
109 0.47
110 0.43
111 0.37
112 0.31
113 0.29
114 0.28
115 0.32
116 0.36
117 0.37
118 0.34
119 0.29
120 0.29
121 0.24
122 0.23
123 0.21
124 0.19
125 0.23
126 0.25
127 0.25
128 0.24
129 0.22
130 0.18
131 0.17
132 0.17
133 0.12
134 0.11
135 0.15
136 0.15
137 0.17
138 0.17
139 0.18
140 0.15
141 0.15
142 0.14
143 0.13
144 0.14
145 0.15
146 0.17
147 0.15
148 0.15
149 0.13
150 0.13
151 0.1
152 0.08
153 0.1
154 0.08
155 0.08
156 0.08
157 0.08
158 0.09
159 0.11
160 0.12
161 0.11
162 0.12
163 0.13
164 0.16
165 0.19
166 0.19
167 0.18
168 0.2
169 0.19
170 0.2
171 0.27
172 0.31
173 0.34
174 0.41
175 0.47
176 0.51
177 0.52
178 0.51
179 0.51
180 0.46
181 0.45
182 0.43
183 0.37
184 0.35
185 0.35
186 0.34
187 0.27
188 0.26
189 0.22
190 0.17
191 0.18
192 0.13
193 0.13
194 0.14
195 0.13
196 0.14
197 0.13
198 0.14
199 0.15
200 0.16
201 0.14
202 0.19
203 0.24
204 0.25
205 0.26
206 0.27
207 0.26
208 0.27
209 0.26
210 0.22
211 0.18
212 0.17
213 0.17
214 0.16
215 0.16
216 0.14
217 0.13
218 0.12
219 0.13
220 0.15
221 0.16
222 0.16
223 0.2
224 0.27
225 0.28
226 0.27
227 0.27
228 0.24
229 0.23
230 0.26
231 0.25
232 0.19
233 0.24
234 0.24
235 0.24
236 0.25
237 0.24
238 0.2
239 0.16
240 0.15
241 0.11
242 0.1
243 0.1
244 0.09
245 0.13
246 0.13
247 0.16
248 0.22
249 0.28
250 0.29
251 0.35