Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YIF7

Protein Details
Accession A0A1Q2YIF7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
261-288YDDMLNHVRNKHRKCRHCKITDPRVLDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000999  RNase_III_dom  
Gene Ontology GO:0004525  F:ribonuclease III activity  
GO:0006396  P:RNA processing  
PROSITE View protein in PROSITE  
PS50142  RNASE_3_2  
Amino Acid Sequences MMRDILSNKNLGYLSRQINLLTETENIPDDSKRHADVLEAYFGGIALEAGTTTYFDKRTDSVREAWNKTALFLLEKSKDKFTAFAALYALENNRRGSEIELICGDTIDPLRKLTQLRNNRMKDLTGLFNAEPDDYERRFSLERLQILGNTTLKYFLTKIYNDNLTDYRVKDLAKLRDSRMKDSKIISLTGKYLDQPSYSLFYSLFNKNKKKTGYGPNATRLKQFLGYIVATHYTKSSNKEMLELFLLGWNECESFVKAIYYDDMLNHVRNKHRKCRHCKITDPRVLDSGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.32
4 0.27
5 0.29
6 0.3
7 0.25
8 0.19
9 0.17
10 0.15
11 0.16
12 0.17
13 0.16
14 0.16
15 0.17
16 0.17
17 0.21
18 0.23
19 0.23
20 0.23
21 0.22
22 0.23
23 0.27
24 0.28
25 0.25
26 0.22
27 0.2
28 0.18
29 0.18
30 0.16
31 0.1
32 0.06
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.05
39 0.06
40 0.09
41 0.1
42 0.11
43 0.14
44 0.15
45 0.2
46 0.26
47 0.28
48 0.31
49 0.38
50 0.46
51 0.47
52 0.48
53 0.49
54 0.43
55 0.39
56 0.36
57 0.28
58 0.22
59 0.2
60 0.23
61 0.23
62 0.28
63 0.3
64 0.31
65 0.33
66 0.31
67 0.3
68 0.26
69 0.28
70 0.24
71 0.22
72 0.2
73 0.19
74 0.18
75 0.18
76 0.18
77 0.12
78 0.14
79 0.14
80 0.14
81 0.14
82 0.15
83 0.16
84 0.22
85 0.19
86 0.19
87 0.18
88 0.18
89 0.17
90 0.16
91 0.14
92 0.08
93 0.08
94 0.09
95 0.09
96 0.1
97 0.11
98 0.14
99 0.16
100 0.22
101 0.3
102 0.38
103 0.47
104 0.56
105 0.57
106 0.58
107 0.56
108 0.5
109 0.43
110 0.36
111 0.29
112 0.2
113 0.2
114 0.17
115 0.17
116 0.16
117 0.14
118 0.11
119 0.11
120 0.14
121 0.12
122 0.14
123 0.13
124 0.14
125 0.15
126 0.15
127 0.2
128 0.21
129 0.21
130 0.22
131 0.22
132 0.2
133 0.21
134 0.23
135 0.16
136 0.13
137 0.12
138 0.11
139 0.1
140 0.11
141 0.1
142 0.1
143 0.13
144 0.13
145 0.15
146 0.18
147 0.21
148 0.2
149 0.22
150 0.2
151 0.2
152 0.21
153 0.19
154 0.18
155 0.17
156 0.17
157 0.19
158 0.25
159 0.29
160 0.32
161 0.35
162 0.36
163 0.42
164 0.44
165 0.47
166 0.48
167 0.44
168 0.42
169 0.41
170 0.42
171 0.37
172 0.36
173 0.3
174 0.24
175 0.22
176 0.2
177 0.19
178 0.15
179 0.16
180 0.15
181 0.14
182 0.13
183 0.14
184 0.15
185 0.15
186 0.15
187 0.12
188 0.14
189 0.18
190 0.24
191 0.29
192 0.34
193 0.42
194 0.45
195 0.52
196 0.52
197 0.53
198 0.55
199 0.59
200 0.61
201 0.63
202 0.65
203 0.68
204 0.72
205 0.67
206 0.61
207 0.52
208 0.44
209 0.37
210 0.31
211 0.24
212 0.21
213 0.2
214 0.18
215 0.17
216 0.18
217 0.16
218 0.16
219 0.15
220 0.15
221 0.18
222 0.22
223 0.27
224 0.29
225 0.29
226 0.32
227 0.32
228 0.31
229 0.3
230 0.25
231 0.2
232 0.18
233 0.18
234 0.14
235 0.14
236 0.12
237 0.11
238 0.11
239 0.12
240 0.11
241 0.12
242 0.13
243 0.13
244 0.12
245 0.13
246 0.14
247 0.14
248 0.13
249 0.12
250 0.16
251 0.18
252 0.22
253 0.25
254 0.29
255 0.37
256 0.46
257 0.54
258 0.61
259 0.69
260 0.76
261 0.82
262 0.87
263 0.89
264 0.88
265 0.9
266 0.9
267 0.91
268 0.89
269 0.84
270 0.76