Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q2YBS2

Protein Details
Accession A0A1Q2YBS2   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-36SERNYVGVKHKVKKREEKRERKALAABasic
161-188AAAGAKSVQPKRKKIKTKRARIEVEYEEHydrophilic
NLS Segment(s)
PositionSequence
19-39KHKVKKREEKRERKALAAARI
169-181QPKRKKIKTKRAR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR006958  Mak16  
Pfam View protein in Pfam  
PF04874  Mak16  
Amino Acid Sequences MALREERGEVSERNYVGVKHKVKKREEKRERKALAAARIEKAIEKELLDRLKSGAYGDKPLNVDDKIWKKVLGKIETRNTEEEQEDEEDYDSDEDDVQLESEDEDEDEGQIEYVEDDENDDEEMVDMEDLEKWLGHDSDASESESEEDDDEGGDDDETKDAAAGAKSVQPKRKKIKTKRARIEVEYEEEPLTNIATS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.28
4 0.36
5 0.41
6 0.44
7 0.51
8 0.58
9 0.66
10 0.76
11 0.8
12 0.82
13 0.85
14 0.87
15 0.9
16 0.92
17 0.85
18 0.78
19 0.75
20 0.7
21 0.67
22 0.64
23 0.58
24 0.49
25 0.47
26 0.43
27 0.37
28 0.32
29 0.27
30 0.19
31 0.16
32 0.17
33 0.21
34 0.24
35 0.23
36 0.22
37 0.2
38 0.19
39 0.18
40 0.17
41 0.18
42 0.16
43 0.2
44 0.2
45 0.22
46 0.22
47 0.23
48 0.25
49 0.19
50 0.19
51 0.22
52 0.27
53 0.27
54 0.27
55 0.28
56 0.27
57 0.32
58 0.38
59 0.37
60 0.36
61 0.4
62 0.47
63 0.49
64 0.5
65 0.48
66 0.41
67 0.37
68 0.33
69 0.26
70 0.21
71 0.18
72 0.16
73 0.13
74 0.12
75 0.1
76 0.09
77 0.09
78 0.07
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.03
100 0.04
101 0.04
102 0.03
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.05
111 0.04
112 0.04
113 0.03
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.06
121 0.07
122 0.06
123 0.07
124 0.08
125 0.11
126 0.12
127 0.13
128 0.12
129 0.12
130 0.13
131 0.12
132 0.12
133 0.09
134 0.08
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.06
146 0.05
147 0.05
148 0.07
149 0.07
150 0.07
151 0.08
152 0.13
153 0.2
154 0.27
155 0.35
156 0.42
157 0.51
158 0.61
159 0.71
160 0.77
161 0.81
162 0.86
163 0.89
164 0.92
165 0.93
166 0.93
167 0.9
168 0.84
169 0.8
170 0.74
171 0.7
172 0.6
173 0.51
174 0.41
175 0.34
176 0.29
177 0.22