Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EB33

Protein Details
Accession A0A177EB33    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-119CPKVLLYIKYYRKHKNKKHQKKRNRDKQQBasic
NLS Segment(s)
PositionSequence
102-117RKHKNKKHQKKRNRDK
Subcellular Location(s) plas 12, E.R. 6, mito 4, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007203  ORMDL  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF04061  ORMDL  
Amino Acid Sequences MFSKQATWSITIWMYNIITFVFFHAILGDPFNLEYSGLTFWEQLMIQLKGSSGITFFTAFPIVLFLFGARIAQFNNVLFLFNLLSLIIVICPKVLLYIKYYRKHKNKKHQKKRNRDKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.11
5 0.1
6 0.09
7 0.1
8 0.09
9 0.09
10 0.09
11 0.09
12 0.1
13 0.09
14 0.11
15 0.09
16 0.07
17 0.08
18 0.08
19 0.08
20 0.07
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.07
27 0.07
28 0.08
29 0.08
30 0.08
31 0.11
32 0.11
33 0.1
34 0.11
35 0.11
36 0.1
37 0.11
38 0.09
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.06
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.04
57 0.04
58 0.05
59 0.06
60 0.07
61 0.07
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.07
69 0.07
70 0.05
71 0.05
72 0.04
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.07
81 0.09
82 0.09
83 0.14
84 0.24
85 0.33
86 0.41
87 0.49
88 0.57
89 0.66
90 0.76
91 0.82
92 0.84
93 0.88
94 0.91
95 0.95
96 0.96
97 0.96
98 0.96
99 0.97