Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177EMU2

Protein Details
Accession A0A177EMU2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-59SPTKRNRSKAVSPKKQPKTKRGTRSHSHydrophilic
NLS Segment(s)
PositionSequence
34-55PTKRNRSKAVSPKKQPKTKRGT
Subcellular Location(s) plas 13, nucl 3, mito 3, E.R. 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDKEGWVYTLILSLIIGTLSLAIFYFYAKKLVSPTKRNRSKAVSPKKQPKTKRGTRSHSGIMSSSNSSVSIEIEATDME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.03
5 0.04
6 0.03
7 0.04
8 0.03
9 0.04
10 0.04
11 0.05
12 0.07
13 0.07
14 0.09
15 0.09
16 0.1
17 0.14
18 0.23
19 0.3
20 0.37
21 0.47
22 0.56
23 0.64
24 0.67
25 0.67
26 0.65
27 0.67
28 0.68
29 0.69
30 0.69
31 0.69
32 0.77
33 0.82
34 0.83
35 0.81
36 0.81
37 0.8
38 0.8
39 0.82
40 0.81
41 0.8
42 0.78
43 0.77
44 0.73
45 0.65
46 0.57
47 0.47
48 0.39
49 0.34
50 0.29
51 0.24
52 0.18
53 0.16
54 0.15
55 0.14
56 0.12
57 0.11
58 0.09
59 0.09