Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177ED29

Protein Details
Accession A0A177ED29    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45LEGARLKRALKKYLRPRTQAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, cyto 6, mito 5, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029055  Ntn_hydrolases_N  
IPR000246  Peptidase_T2  
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MGISWSLDPAMKILAVHLGAGECSALEGARLKRALKKYLRPRTQAQGRGVMEAVEVMKEIESGGLANCGVGSNCTANGAVENEACIMTGPKAFACVCLVPLPLSPTVLASNWLAETAAPGYVKPLTVAYTANPLTNPPPSHILTQPLLRDPNTPKTPKTPNTPKTPAHSDTAGVIYVSDCSGLSGLSGPGTKAGGTDSVCVSSSGGPRNKPPGRVGPCSVYGANTFRAGRVSTCVSGTGEALIRTMICRKVSALIESEDFERIRGELSLYMEEEPEFPHLGGISIFRKSDQTTLLIHFQTAPSFVFGYSVQFQGPDLTRTPEHLQKLVYHSQPSKQVTVQILSIGDTTKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.11
6 0.1
7 0.1
8 0.09
9 0.05
10 0.05
11 0.06
12 0.05
13 0.05
14 0.11
15 0.13
16 0.19
17 0.22
18 0.24
19 0.32
20 0.39
21 0.48
22 0.51
23 0.6
24 0.65
25 0.74
26 0.81
27 0.79
28 0.79
29 0.79
30 0.8
31 0.77
32 0.71
33 0.69
34 0.61
35 0.57
36 0.51
37 0.4
38 0.3
39 0.23
40 0.19
41 0.1
42 0.09
43 0.07
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.09
64 0.1
65 0.11
66 0.11
67 0.09
68 0.1
69 0.09
70 0.09
71 0.09
72 0.08
73 0.08
74 0.07
75 0.08
76 0.09
77 0.08
78 0.11
79 0.11
80 0.12
81 0.13
82 0.13
83 0.13
84 0.14
85 0.14
86 0.12
87 0.13
88 0.15
89 0.13
90 0.13
91 0.11
92 0.11
93 0.12
94 0.11
95 0.12
96 0.09
97 0.1
98 0.09
99 0.09
100 0.08
101 0.06
102 0.07
103 0.06
104 0.07
105 0.07
106 0.06
107 0.08
108 0.08
109 0.09
110 0.08
111 0.08
112 0.08
113 0.09
114 0.1
115 0.09
116 0.14
117 0.15
118 0.15
119 0.14
120 0.14
121 0.15
122 0.19
123 0.19
124 0.15
125 0.19
126 0.2
127 0.23
128 0.23
129 0.25
130 0.22
131 0.25
132 0.24
133 0.23
134 0.23
135 0.21
136 0.25
137 0.25
138 0.32
139 0.36
140 0.37
141 0.35
142 0.4
143 0.48
144 0.47
145 0.53
146 0.55
147 0.54
148 0.61
149 0.66
150 0.62
151 0.6
152 0.62
153 0.54
154 0.46
155 0.4
156 0.31
157 0.25
158 0.23
159 0.18
160 0.11
161 0.09
162 0.06
163 0.06
164 0.05
165 0.04
166 0.03
167 0.03
168 0.04
169 0.03
170 0.03
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.06
178 0.05
179 0.05
180 0.05
181 0.07
182 0.07
183 0.09
184 0.09
185 0.09
186 0.1
187 0.1
188 0.1
189 0.11
190 0.13
191 0.19
192 0.21
193 0.22
194 0.24
195 0.34
196 0.37
197 0.37
198 0.38
199 0.41
200 0.45
201 0.48
202 0.48
203 0.41
204 0.4
205 0.4
206 0.36
207 0.27
208 0.23
209 0.2
210 0.19
211 0.18
212 0.16
213 0.14
214 0.16
215 0.15
216 0.14
217 0.15
218 0.17
219 0.15
220 0.15
221 0.16
222 0.15
223 0.15
224 0.14
225 0.12
226 0.1
227 0.09
228 0.09
229 0.08
230 0.07
231 0.08
232 0.11
233 0.13
234 0.13
235 0.13
236 0.14
237 0.19
238 0.21
239 0.22
240 0.21
241 0.19
242 0.2
243 0.2
244 0.2
245 0.18
246 0.16
247 0.15
248 0.13
249 0.11
250 0.11
251 0.1
252 0.1
253 0.1
254 0.12
255 0.14
256 0.14
257 0.15
258 0.14
259 0.14
260 0.13
261 0.12
262 0.12
263 0.11
264 0.1
265 0.1
266 0.1
267 0.1
268 0.1
269 0.13
270 0.13
271 0.14
272 0.14
273 0.15
274 0.17
275 0.18
276 0.21
277 0.2
278 0.2
279 0.21
280 0.24
281 0.29
282 0.26
283 0.25
284 0.23
285 0.22
286 0.2
287 0.18
288 0.15
289 0.12
290 0.12
291 0.12
292 0.12
293 0.12
294 0.16
295 0.16
296 0.16
297 0.15
298 0.14
299 0.15
300 0.19
301 0.2
302 0.18
303 0.18
304 0.22
305 0.23
306 0.28
307 0.33
308 0.35
309 0.37
310 0.37
311 0.37
312 0.37
313 0.44
314 0.46
315 0.45
316 0.46
317 0.46
318 0.48
319 0.55
320 0.54
321 0.51
322 0.45
323 0.47
324 0.44
325 0.43
326 0.38
327 0.32
328 0.28
329 0.25
330 0.24