Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EAU3

Protein Details
Accession A0A177EAU3   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTQKRRNHGRAKQNRGHTRNIRCENCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MTQKRRNHGRAKQNRGHTRNIRCENCFRCCPKDKAIKRFHIRNVIDTASFDDIKLASVYEDFEVPKFYYKLEYCISCAVHQRIVRSRSAEDRKDRSNPFTRKRQTLLSASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.82
3 0.82
4 0.8
5 0.79
6 0.79
7 0.81
8 0.75
9 0.69
10 0.74
11 0.7
12 0.67
13 0.65
14 0.59
15 0.58
16 0.6
17 0.6
18 0.6
19 0.65
20 0.66
21 0.69
22 0.73
23 0.75
24 0.76
25 0.78
26 0.75
27 0.74
28 0.67
29 0.6
30 0.54
31 0.45
32 0.38
33 0.3
34 0.27
35 0.19
36 0.18
37 0.14
38 0.11
39 0.09
40 0.1
41 0.09
42 0.07
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.08
51 0.08
52 0.11
53 0.11
54 0.11
55 0.16
56 0.16
57 0.2
58 0.21
59 0.22
60 0.2
61 0.24
62 0.25
63 0.21
64 0.27
65 0.25
66 0.28
67 0.28
68 0.32
69 0.36
70 0.38
71 0.39
72 0.36
73 0.38
74 0.42
75 0.5
76 0.52
77 0.53
78 0.56
79 0.6
80 0.65
81 0.66
82 0.64
83 0.66
84 0.68
85 0.68
86 0.73
87 0.75
88 0.74
89 0.74
90 0.73
91 0.7