Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y3E8

Protein Details
Accession G8Y3E8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-102EAYRVKMVEDRKKRNKGAPKKKKEBasic
NLS Segment(s)
PositionSequence
89-102RKKRNKGAPKKKKE
Subcellular Location(s) nucl 15, mito_nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSILKKLPSKARLEQVKKLSSEIFGSTWNPNNIRNGSKILQAPLKGPQLVNYYGVNDTMPTFQDFKKWFPELKLVDPREAYRVKMVEDRKKRNKGAPKKKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.7
3 0.68
4 0.62
5 0.57
6 0.49
7 0.4
8 0.36
9 0.29
10 0.21
11 0.18
12 0.19
13 0.2
14 0.24
15 0.26
16 0.26
17 0.26
18 0.3
19 0.31
20 0.31
21 0.29
22 0.29
23 0.27
24 0.29
25 0.29
26 0.26
27 0.26
28 0.24
29 0.23
30 0.24
31 0.25
32 0.21
33 0.19
34 0.2
35 0.21
36 0.21
37 0.21
38 0.17
39 0.16
40 0.15
41 0.15
42 0.12
43 0.09
44 0.09
45 0.07
46 0.08
47 0.08
48 0.1
49 0.1
50 0.17
51 0.19
52 0.2
53 0.26
54 0.28
55 0.28
56 0.28
57 0.37
58 0.33
59 0.39
60 0.46
61 0.42
62 0.43
63 0.43
64 0.42
65 0.4
66 0.38
67 0.32
68 0.28
69 0.27
70 0.27
71 0.32
72 0.4
73 0.44
74 0.53
75 0.62
76 0.67
77 0.75
78 0.79
79 0.81
80 0.83
81 0.84
82 0.85