Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EAX7

Protein Details
Accession A0A177EAX7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
138-159WITVKGSKTKKKKTPVEEPLSYHydrophilic
NLS Segment(s)
PositionSequence
200-209KKAKANKFKK
Subcellular Location(s) nucl 13.5, cyto_nucl 12.833, cyto 10, mito_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MKHLEEETERVPHVLDELFGKIDSLEEHIPAFLNEDSEILGSDPQKLQLTRKLSQKEKTLLATPPAKRSYTVTYAVEEEVRVTTTPDGLRVDYEETEELGADEPIDWDIKVDGTGYFDAKGNYVKQEEEDSESDQDDWITVKGSKTKKKKTPVEEPLSYTAVQNITPPNPKKVHAKTTVTQASKTDPDTDSEGFTTVKDKKAKANKFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.13
5 0.13
6 0.13
7 0.13
8 0.11
9 0.11
10 0.11
11 0.13
12 0.12
13 0.12
14 0.12
15 0.12
16 0.13
17 0.12
18 0.14
19 0.1
20 0.1
21 0.1
22 0.1
23 0.1
24 0.09
25 0.1
26 0.07
27 0.09
28 0.09
29 0.11
30 0.12
31 0.14
32 0.18
33 0.19
34 0.22
35 0.27
36 0.33
37 0.35
38 0.43
39 0.49
40 0.51
41 0.56
42 0.6
43 0.58
44 0.55
45 0.52
46 0.48
47 0.42
48 0.41
49 0.43
50 0.38
51 0.4
52 0.4
53 0.37
54 0.34
55 0.36
56 0.35
57 0.32
58 0.33
59 0.27
60 0.26
61 0.26
62 0.26
63 0.23
64 0.17
65 0.13
66 0.09
67 0.09
68 0.08
69 0.07
70 0.07
71 0.09
72 0.09
73 0.1
74 0.11
75 0.11
76 0.11
77 0.11
78 0.12
79 0.1
80 0.11
81 0.09
82 0.09
83 0.08
84 0.08
85 0.07
86 0.06
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.05
99 0.04
100 0.06
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.09
107 0.11
108 0.1
109 0.12
110 0.12
111 0.12
112 0.12
113 0.14
114 0.15
115 0.17
116 0.17
117 0.17
118 0.17
119 0.17
120 0.16
121 0.14
122 0.13
123 0.09
124 0.08
125 0.06
126 0.07
127 0.08
128 0.09
129 0.16
130 0.24
131 0.33
132 0.42
133 0.52
134 0.59
135 0.68
136 0.76
137 0.78
138 0.81
139 0.83
140 0.82
141 0.75
142 0.71
143 0.64
144 0.57
145 0.49
146 0.38
147 0.3
148 0.22
149 0.19
150 0.17
151 0.16
152 0.19
153 0.27
154 0.3
155 0.35
156 0.36
157 0.4
158 0.47
159 0.52
160 0.56
161 0.56
162 0.61
163 0.56
164 0.64
165 0.7
166 0.61
167 0.55
168 0.48
169 0.44
170 0.41
171 0.4
172 0.34
173 0.26
174 0.27
175 0.31
176 0.3
177 0.27
178 0.24
179 0.24
180 0.19
181 0.19
182 0.23
183 0.21
184 0.28
185 0.31
186 0.33
187 0.41
188 0.52
189 0.62