Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EB61

Protein Details
Accession A0A177EB61    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
126-153HTDRTGRKKQEQGNPRIKNKRRFQDAHDBasic
NLS Segment(s)
PositionSequence
131-147GRKKQEQGNPRIKNKRR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018972  Sas10_C_dom  
Pfam View protein in Pfam  
PF09368  Sas10  
Amino Acid Sequences MPALAAMETSLPFKNAEEIEKAISLIDTAKPNASLKERLLRCYLLNLLLSSQVDSNHPVKTLLIKLSVYIELVDKATHAVAPAGSNILKEHKAPETSDLNEEDLEDGTQTLDRRPINYVMAKNKTHTDRTGRKKQEQGNPRIKNKRRFQDAHDLAKKVRDTHHASKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.2
5 0.22
6 0.23
7 0.23
8 0.22
9 0.17
10 0.15
11 0.13
12 0.11
13 0.13
14 0.13
15 0.14
16 0.15
17 0.17
18 0.18
19 0.22
20 0.24
21 0.25
22 0.26
23 0.34
24 0.35
25 0.36
26 0.38
27 0.36
28 0.32
29 0.32
30 0.3
31 0.23
32 0.22
33 0.19
34 0.16
35 0.16
36 0.16
37 0.13
38 0.12
39 0.1
40 0.1
41 0.13
42 0.15
43 0.13
44 0.14
45 0.13
46 0.13
47 0.15
48 0.17
49 0.15
50 0.15
51 0.14
52 0.14
53 0.15
54 0.15
55 0.12
56 0.1
57 0.09
58 0.07
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.08
75 0.09
76 0.09
77 0.11
78 0.13
79 0.14
80 0.14
81 0.18
82 0.2
83 0.2
84 0.22
85 0.21
86 0.19
87 0.18
88 0.17
89 0.13
90 0.1
91 0.09
92 0.06
93 0.05
94 0.05
95 0.07
96 0.07
97 0.07
98 0.12
99 0.13
100 0.14
101 0.17
102 0.19
103 0.22
104 0.27
105 0.32
106 0.35
107 0.41
108 0.41
109 0.4
110 0.44
111 0.45
112 0.43
113 0.43
114 0.44
115 0.48
116 0.57
117 0.65
118 0.67
119 0.7
120 0.75
121 0.78
122 0.78
123 0.78
124 0.79
125 0.79
126 0.8
127 0.83
128 0.85
129 0.86
130 0.86
131 0.86
132 0.86
133 0.85
134 0.8
135 0.77
136 0.78
137 0.77
138 0.78
139 0.75
140 0.67
141 0.58
142 0.61
143 0.56
144 0.48
145 0.45
146 0.43
147 0.45