Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YR42

Protein Details
Accession G8YR42    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
181-202KAGRAFHKYKAKRNSWPKTRGVHydrophilic
NLS Segment(s)
PositionSequence
180-194LKAGRAFHKYKAKRN
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR022666  Rbsml_prot_L2_RNA-bd_dom  
IPR014722  Rib_L2_dom2  
IPR002171  Ribosomal_L2  
IPR022669  Ribosomal_L2_C  
IPR022671  Ribosomal_L2_CS  
IPR014726  Ribosomal_L2_dom3  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00181  Ribosomal_L2  
PF03947  Ribosomal_L2_C  
PROSITE View protein in PROSITE  
PS00467  RIBOSOMAL_L2  
Amino Acid Sequences MGRVIRNQRKGAGSVFTAHTRLRKGAAKLRTLDYAERHGYIRGVVKQIIHDSGRGAPLAKVAFRDPYKYKLREETFIANEGVYTGQFVYAGKKASLNVGNILPLGSMPEGTIVSNVEEKVGDRGALGRTSGNYVIIIGHNPDEGKTRVKMPSGAKKILSSEARGVIGVVAGGGRIDKPLLKAGRAFHKYKAKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVPGQKAGLIAARRTGLLRGTQKTQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.31
4 0.3
5 0.3
6 0.31
7 0.3
8 0.31
9 0.32
10 0.35
11 0.39
12 0.45
13 0.5
14 0.52
15 0.53
16 0.54
17 0.53
18 0.5
19 0.47
20 0.42
21 0.42
22 0.37
23 0.35
24 0.33
25 0.29
26 0.26
27 0.25
28 0.27
29 0.24
30 0.25
31 0.25
32 0.25
33 0.27
34 0.29
35 0.3
36 0.25
37 0.21
38 0.2
39 0.21
40 0.21
41 0.19
42 0.17
43 0.13
44 0.16
45 0.17
46 0.16
47 0.15
48 0.15
49 0.21
50 0.21
51 0.27
52 0.27
53 0.33
54 0.41
55 0.43
56 0.45
57 0.48
58 0.5
59 0.47
60 0.48
61 0.47
62 0.4
63 0.39
64 0.36
65 0.26
66 0.23
67 0.2
68 0.16
69 0.09
70 0.07
71 0.05
72 0.04
73 0.05
74 0.05
75 0.08
76 0.09
77 0.11
78 0.11
79 0.12
80 0.12
81 0.17
82 0.19
83 0.17
84 0.17
85 0.16
86 0.16
87 0.15
88 0.15
89 0.1
90 0.07
91 0.07
92 0.05
93 0.05
94 0.04
95 0.05
96 0.05
97 0.05
98 0.06
99 0.05
100 0.06
101 0.07
102 0.07
103 0.06
104 0.06
105 0.07
106 0.08
107 0.08
108 0.07
109 0.05
110 0.07
111 0.08
112 0.08
113 0.09
114 0.07
115 0.08
116 0.09
117 0.09
118 0.08
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.09
130 0.1
131 0.13
132 0.13
133 0.16
134 0.18
135 0.19
136 0.25
137 0.28
138 0.36
139 0.4
140 0.41
141 0.39
142 0.38
143 0.38
144 0.39
145 0.34
146 0.26
147 0.23
148 0.22
149 0.21
150 0.2
151 0.18
152 0.12
153 0.1
154 0.08
155 0.05
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.04
163 0.05
164 0.07
165 0.14
166 0.16
167 0.17
168 0.2
169 0.24
170 0.33
171 0.38
172 0.39
173 0.39
174 0.49
175 0.54
176 0.61
177 0.67
178 0.64
179 0.69
180 0.78
181 0.81
182 0.81
183 0.82
184 0.78
185 0.73
186 0.71
187 0.66
188 0.59
189 0.58
190 0.51
191 0.5
192 0.45
193 0.42
194 0.38
195 0.33
196 0.3
197 0.22
198 0.2
199 0.17
200 0.19
201 0.21
202 0.26
203 0.27
204 0.27
205 0.26
206 0.26
207 0.25
208 0.24
209 0.21
210 0.19
211 0.2
212 0.2
213 0.2
214 0.2
215 0.22
216 0.23
217 0.24
218 0.22
219 0.21
220 0.21
221 0.2
222 0.19
223 0.22
224 0.19
225 0.18
226 0.2
227 0.2
228 0.2
229 0.21
230 0.22
231 0.19
232 0.25
233 0.32
234 0.33