Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EJU6

Protein Details
Accession A0A177EJU6   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-54SHPFKFTTNPPGKKRKMQPEERYHPGPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 6, nucl 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040202  Brl1/Brr6  
IPR018767  Brl1/Brr6_dom  
Gene Ontology GO:0031965  C:nuclear membrane  
GO:0055088  P:lipid homeostasis  
GO:0006998  P:nuclear envelope organization  
Pfam View protein in Pfam  
PF10104  Brr6_like_C_C  
Amino Acid Sequences MHFQASAPPETPSIHWGRSAERNPVSKSHPFKFTTNPPGKKRKMQPEERYHPGPFTNPPSTTPIHTTPTQIYTPVHPPVHPPTPTSSLPFYDQLIRVNYIASAYISLFMNAFLICMFILLAVKFTVTVKNDLSIKYLNLIESNKSLIAESKRQYLVNRCAPEQRVPALEAQCREWEQCMAKDPFREELTKVIFKIASDSLEEFLSGVSFRTVGICMVALAVFLKMRSANHKHTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.31
5 0.39
6 0.42
7 0.44
8 0.46
9 0.51
10 0.51
11 0.54
12 0.54
13 0.54
14 0.57
15 0.53
16 0.55
17 0.52
18 0.52
19 0.55
20 0.59
21 0.61
22 0.64
23 0.68
24 0.68
25 0.75
26 0.78
27 0.8
28 0.8
29 0.81
30 0.81
31 0.83
32 0.85
33 0.85
34 0.87
35 0.84
36 0.79
37 0.69
38 0.61
39 0.51
40 0.44
41 0.38
42 0.38
43 0.36
44 0.32
45 0.33
46 0.35
47 0.36
48 0.35
49 0.35
50 0.31
51 0.29
52 0.29
53 0.3
54 0.28
55 0.3
56 0.28
57 0.24
58 0.22
59 0.21
60 0.25
61 0.28
62 0.27
63 0.23
64 0.26
65 0.31
66 0.37
67 0.34
68 0.31
69 0.3
70 0.34
71 0.35
72 0.34
73 0.3
74 0.24
75 0.26
76 0.26
77 0.22
78 0.2
79 0.2
80 0.2
81 0.2
82 0.19
83 0.17
84 0.16
85 0.14
86 0.11
87 0.1
88 0.07
89 0.06
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.06
97 0.05
98 0.05
99 0.03
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.08
113 0.09
114 0.11
115 0.11
116 0.13
117 0.15
118 0.15
119 0.17
120 0.15
121 0.14
122 0.14
123 0.14
124 0.12
125 0.13
126 0.13
127 0.12
128 0.12
129 0.13
130 0.11
131 0.11
132 0.11
133 0.13
134 0.16
135 0.21
136 0.21
137 0.25
138 0.27
139 0.28
140 0.31
141 0.35
142 0.4
143 0.42
144 0.43
145 0.39
146 0.43
147 0.45
148 0.46
149 0.41
150 0.35
151 0.29
152 0.28
153 0.31
154 0.3
155 0.3
156 0.26
157 0.25
158 0.26
159 0.25
160 0.25
161 0.22
162 0.22
163 0.22
164 0.23
165 0.29
166 0.3
167 0.31
168 0.33
169 0.34
170 0.35
171 0.34
172 0.34
173 0.28
174 0.3
175 0.34
176 0.34
177 0.32
178 0.3
179 0.28
180 0.26
181 0.29
182 0.23
183 0.18
184 0.17
185 0.18
186 0.16
187 0.16
188 0.16
189 0.12
190 0.1
191 0.09
192 0.07
193 0.07
194 0.06
195 0.06
196 0.06
197 0.07
198 0.08
199 0.08
200 0.08
201 0.08
202 0.07
203 0.08
204 0.07
205 0.06
206 0.06
207 0.07
208 0.07
209 0.07
210 0.09
211 0.1
212 0.13
213 0.22
214 0.29