Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EIJ4

Protein Details
Accession A0A177EIJ4    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNQNQNRKAHRNGIKKPRQVHydrophilic
NLS Segment(s)
PositionSequence
21-23IKK
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNQNQNRKAHRNGIKKPRQVDRLPTRGMPAAALAEMRRAENEKYPVSKKKTMSFEERNAMEGQNPSVARKRYIVKMGIERMARKGIYLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.77
4 0.77
5 0.76
6 0.76
7 0.8
8 0.8
9 0.79
10 0.8
11 0.78
12 0.76
13 0.7
14 0.71
15 0.69
16 0.66
17 0.62
18 0.56
19 0.5
20 0.44
21 0.4
22 0.29
23 0.2
24 0.13
25 0.11
26 0.1
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.1
33 0.11
34 0.14
35 0.18
36 0.18
37 0.22
38 0.27
39 0.34
40 0.38
41 0.43
42 0.43
43 0.46
44 0.51
45 0.52
46 0.56
47 0.55
48 0.54
49 0.54
50 0.51
51 0.46
52 0.4
53 0.35
54 0.29
55 0.23
56 0.19
57 0.17
58 0.17
59 0.18
60 0.24
61 0.25
62 0.25
63 0.29
64 0.33
65 0.35
66 0.41
67 0.43
68 0.42
69 0.48
70 0.51
71 0.53
72 0.52
73 0.47
74 0.45
75 0.46
76 0.39