Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177EDH2

Protein Details
Accession A0A177EDH2    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-92QGVIIKKRRNAKEEMRKKKKWBasic
NLS Segment(s)
PositionSequence
41-60PKKKSTTYKHRKVLAERESK
65-66RR
70-92RDQGVIIKKRRNAKEEMRKKKKW
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
Amino Acid Sequences MQKERPRDLIPEVRKYISKRIGGSEVIRTLRDTLDVLGVKPKKKSTTYKHRKVLAERESKAFDERRESLRDQGVIIKKRRNAKEEMRKKKKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.56
4 0.54
5 0.51
6 0.44
7 0.45
8 0.45
9 0.43
10 0.42
11 0.37
12 0.34
13 0.31
14 0.29
15 0.25
16 0.23
17 0.2
18 0.19
19 0.14
20 0.1
21 0.13
22 0.13
23 0.13
24 0.19
25 0.22
26 0.23
27 0.25
28 0.27
29 0.27
30 0.32
31 0.41
32 0.43
33 0.52
34 0.61
35 0.68
36 0.72
37 0.75
38 0.74
39 0.71
40 0.71
41 0.69
42 0.67
43 0.59
44 0.55
45 0.51
46 0.47
47 0.46
48 0.39
49 0.32
50 0.29
51 0.31
52 0.32
53 0.34
54 0.35
55 0.36
56 0.37
57 0.36
58 0.31
59 0.35
60 0.39
61 0.42
62 0.46
63 0.48
64 0.49
65 0.58
66 0.64
67 0.61
68 0.61
69 0.65
70 0.7
71 0.74
72 0.8