Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YFA2

Protein Details
Accession G8YFA2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
167-186AEERHKRFEEKRKAHYHMKABasic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007062  PPI-2  
Gene Ontology GO:0004864  F:protein phosphatase inhibitor activity  
GO:0043666  P:regulation of phosphoprotein phosphatase activity  
GO:0009966  P:regulation of signal transduction  
Pfam View protein in Pfam  
PF04979  IPP-2  
Amino Acid Sequences MSSSKPRGILRNKQDEARSNPNAEFLDRQEVIRNTRLNSKLASDSSQGDKIRAQIAEKKSKKGEDDKYPEHLHWDEVNLYKTEQEKSATMKIDEPKTPYEGGFNPEGEYYRDDDEEQIPEFELGQGEEDEDVAEDTPAQSTSRSLNGGEVVPSLEQEEEQPTKPETAEERHKRFEEKRKAHYHMKAAPLKFNAANVDDDDEEEQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.69
4 0.68
5 0.63
6 0.55
7 0.52
8 0.51
9 0.46
10 0.4
11 0.35
12 0.28
13 0.31
14 0.28
15 0.28
16 0.31
17 0.33
18 0.35
19 0.38
20 0.38
21 0.32
22 0.41
23 0.42
24 0.37
25 0.36
26 0.35
27 0.33
28 0.32
29 0.33
30 0.26
31 0.27
32 0.29
33 0.33
34 0.3
35 0.26
36 0.26
37 0.25
38 0.27
39 0.24
40 0.23
41 0.25
42 0.32
43 0.42
44 0.44
45 0.47
46 0.47
47 0.5
48 0.52
49 0.54
50 0.54
51 0.54
52 0.59
53 0.57
54 0.59
55 0.58
56 0.53
57 0.48
58 0.41
59 0.33
60 0.25
61 0.23
62 0.19
63 0.19
64 0.21
65 0.17
66 0.16
67 0.16
68 0.17
69 0.17
70 0.15
71 0.15
72 0.15
73 0.18
74 0.22
75 0.21
76 0.2
77 0.23
78 0.26
79 0.28
80 0.28
81 0.27
82 0.24
83 0.25
84 0.25
85 0.2
86 0.19
87 0.16
88 0.17
89 0.16
90 0.15
91 0.13
92 0.13
93 0.13
94 0.12
95 0.12
96 0.11
97 0.11
98 0.11
99 0.11
100 0.12
101 0.12
102 0.13
103 0.12
104 0.1
105 0.09
106 0.09
107 0.09
108 0.08
109 0.07
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.06
126 0.06
127 0.07
128 0.09
129 0.11
130 0.12
131 0.12
132 0.12
133 0.13
134 0.14
135 0.13
136 0.11
137 0.1
138 0.09
139 0.09
140 0.09
141 0.07
142 0.07
143 0.07
144 0.13
145 0.14
146 0.16
147 0.18
148 0.18
149 0.2
150 0.2
151 0.22
152 0.2
153 0.25
154 0.35
155 0.43
156 0.48
157 0.54
158 0.56
159 0.6
160 0.65
161 0.69
162 0.69
163 0.68
164 0.72
165 0.74
166 0.79
167 0.81
168 0.79
169 0.78
170 0.73
171 0.74
172 0.72
173 0.65
174 0.65
175 0.58
176 0.55
177 0.46
178 0.42
179 0.36
180 0.3
181 0.3
182 0.25
183 0.26
184 0.22
185 0.23