Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177ECM6

Protein Details
Accession A0A177ECM6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-101REYIQKQKKLREEYTKPRRWEKDKRETRPRRRBasic
NLS Segment(s)
PositionSequence
77-101KKLREEYTKPRRWEKDKRETRPRRR
Subcellular Location(s) nucl 17, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
IPR044976  FIPS3/FIPS5-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences MQGAYIEEERDSSEDFEITLNDEQEAPPEATELLDAHGIDCDTLQDKPWKKPGEDITDYFNYGFNETTWREYIQKQKKLREEYTKPRRWEKDKRETRPRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.13
6 0.13
7 0.12
8 0.11
9 0.12
10 0.11
11 0.12
12 0.15
13 0.12
14 0.1
15 0.1
16 0.09
17 0.09
18 0.1
19 0.08
20 0.06
21 0.07
22 0.07
23 0.06
24 0.07
25 0.07
26 0.06
27 0.06
28 0.05
29 0.06
30 0.06
31 0.08
32 0.14
33 0.18
34 0.21
35 0.29
36 0.31
37 0.3
38 0.36
39 0.41
40 0.42
41 0.43
42 0.4
43 0.38
44 0.36
45 0.36
46 0.31
47 0.26
48 0.18
49 0.15
50 0.15
51 0.09
52 0.13
53 0.13
54 0.16
55 0.16
56 0.17
57 0.19
58 0.23
59 0.33
60 0.39
61 0.47
62 0.51
63 0.58
64 0.65
65 0.71
66 0.75
67 0.75
68 0.75
69 0.77
70 0.82
71 0.82
72 0.79
73 0.81
74 0.82
75 0.81
76 0.82
77 0.82
78 0.82
79 0.84
80 0.89
81 0.9