Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EK21

Protein Details
Accession A0A177EK21   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRGKKVKKTGRTEKSAQTPNHydrophilic
NLS Segment(s)
PositionSequence
233-242KAQTKARGRR
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015216  SANTA  
Pfam View protein in Pfam  
PF09133  SANTA  
Amino Acid Sequences MRGKKVKKTGRTEKSAQTPNTADAIVGCLGSGSDCRIFQRKGSFRSTEHSELISSVLAELSETGEGWARDESSASEIVVPSEPIRSESRHVVLTQWAIKLVRGEDGVFGLVVLGIIKETDNIAQSSFINKRLSSHCVMSKSTTYTLEGQFDNTFTPYPGFRPEALQRFKDGFPAKWSFIINTEISQITGTPSSPTNLTNPQPPKAQSNPNPNPNPQPPKAQTSPNKENLPKTKAQTKARGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.7
4 0.66
5 0.58
6 0.52
7 0.48
8 0.39
9 0.29
10 0.2
11 0.21
12 0.15
13 0.12
14 0.09
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.1
21 0.11
22 0.15
23 0.22
24 0.23
25 0.27
26 0.37
27 0.42
28 0.45
29 0.51
30 0.52
31 0.48
32 0.53
33 0.56
34 0.5
35 0.43
36 0.39
37 0.32
38 0.28
39 0.27
40 0.21
41 0.13
42 0.09
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.07
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.09
64 0.1
65 0.1
66 0.09
67 0.08
68 0.09
69 0.09
70 0.11
71 0.13
72 0.14
73 0.16
74 0.2
75 0.21
76 0.21
77 0.21
78 0.19
79 0.2
80 0.21
81 0.2
82 0.17
83 0.16
84 0.15
85 0.15
86 0.16
87 0.14
88 0.12
89 0.1
90 0.1
91 0.09
92 0.09
93 0.08
94 0.07
95 0.06
96 0.04
97 0.03
98 0.03
99 0.03
100 0.02
101 0.02
102 0.02
103 0.02
104 0.03
105 0.03
106 0.04
107 0.05
108 0.05
109 0.06
110 0.07
111 0.07
112 0.11
113 0.12
114 0.16
115 0.16
116 0.16
117 0.19
118 0.21
119 0.25
120 0.23
121 0.25
122 0.25
123 0.26
124 0.27
125 0.26
126 0.25
127 0.24
128 0.23
129 0.21
130 0.19
131 0.19
132 0.2
133 0.2
134 0.18
135 0.17
136 0.16
137 0.16
138 0.14
139 0.12
140 0.11
141 0.09
142 0.1
143 0.09
144 0.1
145 0.13
146 0.15
147 0.15
148 0.19
149 0.26
150 0.34
151 0.37
152 0.37
153 0.36
154 0.37
155 0.37
156 0.4
157 0.36
158 0.29
159 0.31
160 0.34
161 0.33
162 0.32
163 0.32
164 0.25
165 0.25
166 0.27
167 0.21
168 0.17
169 0.18
170 0.16
171 0.15
172 0.14
173 0.12
174 0.1
175 0.1
176 0.1
177 0.09
178 0.1
179 0.12
180 0.13
181 0.14
182 0.16
183 0.22
184 0.24
185 0.31
186 0.35
187 0.37
188 0.41
189 0.42
190 0.45
191 0.46
192 0.54
193 0.53
194 0.6
195 0.66
196 0.71
197 0.74
198 0.71
199 0.73
200 0.72
201 0.72
202 0.64
203 0.65
204 0.6
205 0.63
206 0.63
207 0.65
208 0.64
209 0.65
210 0.72
211 0.7
212 0.74
213 0.71
214 0.76
215 0.75
216 0.72
217 0.69
218 0.67
219 0.66
220 0.67
221 0.71
222 0.72