Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177EJB5

Protein Details
Accession A0A177EJB5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-41QKKTAGAKVKATKKKEPKKWVKTTVKETTMRHydrophilic
NLS Segment(s)
PositionSequence
5-30KVDPKAQKKTAGAKVKATKKKEPKKW
Subcellular Location(s) nucl 16, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAAKKVDPKAQKKTAGAKVKATKKKEPKKWVKTTVKETTMRNVIINEESFNKIKKEVLGMTVISPSNISTKNNITVSLAKRILSAIVKTGEIEVIAHSSFGSIYGKKEAKVIAEEVVEPAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.7
4 0.69
5 0.7
6 0.73
7 0.75
8 0.72
9 0.73
10 0.74
11 0.81
12 0.82
13 0.84
14 0.85
15 0.87
16 0.91
17 0.92
18 0.91
19 0.88
20 0.87
21 0.85
22 0.8
23 0.74
24 0.65
25 0.61
26 0.55
27 0.47
28 0.39
29 0.31
30 0.25
31 0.23
32 0.21
33 0.16
34 0.14
35 0.16
36 0.16
37 0.17
38 0.16
39 0.15
40 0.15
41 0.14
42 0.15
43 0.13
44 0.14
45 0.14
46 0.13
47 0.13
48 0.14
49 0.13
50 0.1
51 0.09
52 0.08
53 0.09
54 0.1
55 0.11
56 0.12
57 0.14
58 0.18
59 0.19
60 0.19
61 0.18
62 0.23
63 0.24
64 0.29
65 0.28
66 0.23
67 0.23
68 0.23
69 0.23
70 0.19
71 0.17
72 0.14
73 0.14
74 0.14
75 0.14
76 0.14
77 0.12
78 0.1
79 0.1
80 0.07
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.07
88 0.1
89 0.09
90 0.11
91 0.2
92 0.22
93 0.22
94 0.25
95 0.25
96 0.25
97 0.28
98 0.27
99 0.22
100 0.21
101 0.21
102 0.21