Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EF00

Protein Details
Accession A0A177EF00    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDPRMNKIARRERRNTRMADHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10.833, cyto_nucl 5.333, cyto 5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015946  KH_dom-like_a/b  
IPR009019  KH_sf_prok-type  
IPR001351  Ribosomal_S3_C  
IPR036419  Ribosomal_S3_C_sf  
IPR005703  Ribosomal_S3_euk/arc  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0030688  C:preribosome, small subunit precursor  
GO:0003906  F:DNA-(apurinic or apyrimidinic site) endonuclease activity  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0000056  P:ribosomal small subunit export from nucleus  
GO:0006407  P:rRNA export from nucleus  
Pfam View protein in Pfam  
PF00189  Ribosomal_S3_C  
CDD cd02413  KH-II_40S_S3  
Amino Acid Sequences MDPRMNKIARRERRNTRMADDLVIVNQGVMYAELNEFFSKHLQNDGYAGMDYKPYASPIEITLKLGKPTNVLEHNKLRIKQLISLIQMRFGLPEGSVSIFVEQVKNRALSPQIQAEMIREKLGTAIPVRRAVSSALRTIMEGGAAGVQVIVSGKIRGQRAKSYKVSSGTLLHSGNATNDYVKKAQSSILLKQGVLGIKVAITLNHDPTGKNGAAAQHPTKITIFSREELAEMNKTKPAAKTYHQRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.74
4 0.72
5 0.64
6 0.57
7 0.48
8 0.4
9 0.32
10 0.28
11 0.22
12 0.13
13 0.11
14 0.09
15 0.07
16 0.06
17 0.05
18 0.06
19 0.06
20 0.07
21 0.09
22 0.09
23 0.09
24 0.1
25 0.14
26 0.15
27 0.15
28 0.2
29 0.19
30 0.19
31 0.21
32 0.2
33 0.18
34 0.16
35 0.16
36 0.11
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.11
43 0.1
44 0.11
45 0.13
46 0.19
47 0.18
48 0.2
49 0.24
50 0.25
51 0.26
52 0.27
53 0.25
54 0.21
55 0.22
56 0.26
57 0.3
58 0.32
59 0.35
60 0.39
61 0.46
62 0.49
63 0.48
64 0.45
65 0.42
66 0.4
67 0.38
68 0.37
69 0.35
70 0.33
71 0.38
72 0.35
73 0.31
74 0.3
75 0.26
76 0.21
77 0.16
78 0.14
79 0.07
80 0.08
81 0.07
82 0.07
83 0.08
84 0.07
85 0.07
86 0.07
87 0.08
88 0.1
89 0.09
90 0.11
91 0.12
92 0.13
93 0.12
94 0.13
95 0.14
96 0.14
97 0.17
98 0.17
99 0.16
100 0.16
101 0.16
102 0.16
103 0.17
104 0.15
105 0.13
106 0.1
107 0.09
108 0.09
109 0.09
110 0.09
111 0.08
112 0.11
113 0.13
114 0.16
115 0.17
116 0.16
117 0.16
118 0.17
119 0.19
120 0.18
121 0.18
122 0.16
123 0.15
124 0.15
125 0.15
126 0.14
127 0.09
128 0.07
129 0.05
130 0.04
131 0.04
132 0.04
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.05
141 0.1
142 0.13
143 0.17
144 0.2
145 0.28
146 0.34
147 0.41
148 0.45
149 0.45
150 0.47
151 0.47
152 0.45
153 0.39
154 0.36
155 0.3
156 0.29
157 0.25
158 0.21
159 0.18
160 0.17
161 0.15
162 0.14
163 0.12
164 0.1
165 0.11
166 0.15
167 0.15
168 0.16
169 0.16
170 0.15
171 0.17
172 0.22
173 0.25
174 0.25
175 0.31
176 0.32
177 0.3
178 0.3
179 0.32
180 0.26
181 0.22
182 0.19
183 0.11
184 0.1
185 0.12
186 0.11
187 0.08
188 0.12
189 0.14
190 0.17
191 0.2
192 0.21
193 0.2
194 0.22
195 0.28
196 0.23
197 0.2
198 0.19
199 0.2
200 0.24
201 0.3
202 0.3
203 0.29
204 0.3
205 0.31
206 0.3
207 0.3
208 0.27
209 0.29
210 0.3
211 0.26
212 0.3
213 0.28
214 0.28
215 0.27
216 0.29
217 0.28
218 0.27
219 0.28
220 0.27
221 0.27
222 0.3
223 0.31
224 0.33
225 0.33
226 0.38