Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177EE52

Protein Details
Accession A0A177EE52    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-41KVRGTTPKVAKENKKRPKKGRAAKRVLYEKBasic
NLS Segment(s)
PositionSequence
12-37KVRGTTPKVAKENKKRPKKGRAAKRV
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MAKAISLNKTGKVRGTTPKVAKENKKRPKKGRAAKRVLYEKRVKEGYFEGTMKMNSQEVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.49
4 0.51
5 0.58
6 0.6
7 0.64
8 0.69
9 0.71
10 0.74
11 0.76
12 0.81
13 0.82
14 0.84
15 0.87
16 0.88
17 0.86
18 0.86
19 0.87
20 0.85
21 0.81
22 0.8
23 0.8
24 0.73
25 0.72
26 0.69
27 0.61
28 0.59
29 0.58
30 0.5
31 0.43
32 0.42
33 0.39
34 0.36
35 0.33
36 0.28
37 0.27
38 0.27
39 0.26
40 0.25