FuNGI

A0A177EE13

Protein Details

Accession

A0A177EE13

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
1-20	MDWKRICCRRKQEPEEGAAG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 22, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR011356 Leucine_aapep/pepB IPR043472 Macro_dom-like IPR000819 Peptidase_M17_C IPR023042 Peptidase_M17_leu_NH2_pept
Gene Ontology	GO:0005737 C:cytoplasm GO:0030145 F:manganese ion binding GO:0070006 F:metalloaminopeptidase activity GO:0006508 P:proteolysis
Pfam	View protein in Pfam PF00883 Peptidase_M17
PROSITE	View protein in PROSITE PS00631 CYTOSOL_AP
CDD	cd00433 Peptidase_M17

Amino Acid Sequences

MDWKRICCRRKQEPEEGAAGGVVLYSDTIEAPAEIKACIATLPENEQSKWTIYLEKKTYIVCKLSAEKVACPVYVRKTAAKATQGLIQEGVRNIIIEDGYMAEWVAEAVVVGSYQYDVLHSKKKTQVNVIYGGSDAKVEKAIVSGEAQNFARFLVDTPANLMTPTLFTEYAKEYLPKEVEVKVYGKSELAKMKMNLLLGVSNGSAEEPKLLEIKYLKGDQTVALVGKGVTFDSGGISLKPSAKMALMKGDMAGGASVVATIGALARLSAKTSVIGIIPLTENLPSGTATKPGDVHVGAAGKSVEVDNTDAEGRLILGDALHHALSFNPAKIVDVATLTGAMSVALGAVMAGLFTNSDELGSELLSASACAADPIWRMPVTDDYKSLISSDVADIKNIGGPAGGSITAALFLKEFVGTTPWAHLDIAGVAGSTLTPELHGKGATGRPVKLLVHWLAKE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.81
2	0.75
3	0.65
4	0.54
5	0.42
6	0.33
7	0.22
8	0.14
9	0.09
10	0.04
11	0.04
12	0.04
13	0.04
14	0.04
15	0.05
16	0.05
17	0.06
18	0.07
19	0.08
20	0.09
21	0.09
22	0.09
23	0.08
24	0.08
25	0.08
26	0.09
27	0.1
28	0.12
29	0.17
30	0.23
31	0.27
32	0.27
33	0.29
34	0.29
35	0.29
36	0.29
37	0.25
38	0.28
39	0.29
40	0.38
41	0.41
42	0.42
43	0.41
44	0.42
45	0.46
46	0.43
47	0.42
48	0.34
49	0.35
50	0.37
51	0.38
52	0.41
53	0.38
54	0.34
55	0.37
56	0.37
57	0.32
58	0.3
59	0.31
60	0.3
61	0.35
62	0.37
63	0.34
64	0.37
65	0.41
66	0.44
67	0.43
68	0.4
69	0.35
70	0.37
71	0.35
72	0.32
73	0.28
74	0.24
75	0.22
76	0.2
77	0.19
78	0.14
79	0.13
80	0.12
81	0.11
82	0.1
83	0.07
84	0.07
85	0.06
86	0.07
87	0.06
88	0.06
89	0.05
90	0.05
91	0.05
92	0.04
93	0.03
94	0.02
95	0.03
96	0.03
97	0.03
98	0.03
99	0.03
100	0.03
101	0.04
102	0.04
103	0.05
104	0.08
105	0.11
106	0.19
107	0.2
108	0.27
109	0.34
110	0.4
111	0.43
112	0.49
113	0.53
114	0.49
115	0.54
116	0.48
117	0.4
118	0.35
119	0.32
120	0.23
121	0.17
122	0.13
123	0.08
124	0.08
125	0.08
126	0.07
127	0.08
128	0.08
129	0.08
130	0.09
131	0.12
132	0.12
133	0.15
134	0.15
135	0.14
136	0.14
137	0.13
138	0.12
139	0.09
140	0.09
141	0.11
142	0.11
143	0.11
144	0.13
145	0.14
146	0.13
147	0.13
148	0.12
149	0.08
150	0.08
151	0.09
152	0.09
153	0.09
154	0.09
155	0.11
156	0.13
157	0.14
158	0.15
159	0.15
160	0.14
161	0.18
162	0.18
163	0.17
164	0.17
165	0.18
166	0.18
167	0.19
168	0.19
169	0.17
170	0.17
171	0.17
172	0.15
173	0.15
174	0.17
175	0.18
176	0.19
177	0.21
178	0.2
179	0.23
180	0.24
181	0.23
182	0.19
183	0.15
184	0.14
185	0.1
186	0.1
187	0.07
188	0.05
189	0.05
190	0.05
191	0.05
192	0.04
193	0.05
194	0.04
195	0.05
196	0.07
197	0.07
198	0.08
199	0.09
200	0.11
201	0.14
202	0.15
203	0.14
204	0.14
205	0.14
206	0.12
207	0.13
208	0.12
209	0.09
210	0.07
211	0.07
212	0.07
213	0.06
214	0.06
215	0.05
216	0.04
217	0.04
218	0.04
219	0.04
220	0.05
221	0.05
222	0.05
223	0.05
224	0.07
225	0.08
226	0.09
227	0.09
228	0.09
229	0.1
230	0.11
231	0.11
232	0.14
233	0.13
234	0.13
235	0.12
236	0.12
237	0.11
238	0.09
239	0.08
240	0.04
241	0.03
242	0.03
243	0.02
244	0.02
245	0.02
246	0.02
247	0.02
248	0.02
249	0.02
250	0.02
251	0.02
252	0.04
253	0.04
254	0.05
255	0.06
256	0.06
257	0.06
258	0.07
259	0.07
260	0.06
261	0.07
262	0.06
263	0.06
264	0.07
265	0.07
266	0.07
267	0.06
268	0.06
269	0.06
270	0.07
271	0.06
272	0.08
273	0.08
274	0.11
275	0.12
276	0.13
277	0.13
278	0.13
279	0.15
280	0.13
281	0.13
282	0.12
283	0.13
284	0.11
285	0.12
286	0.11
287	0.08
288	0.09
289	0.08
290	0.06
291	0.06
292	0.07
293	0.06
294	0.08
295	0.08
296	0.08
297	0.08
298	0.07
299	0.07
300	0.06
301	0.05
302	0.04
303	0.04
304	0.04
305	0.05
306	0.06
307	0.06
308	0.06
309	0.06
310	0.06
311	0.11
312	0.13
313	0.12
314	0.12
315	0.12
316	0.13
317	0.14
318	0.14
319	0.1
320	0.09
321	0.09
322	0.08
323	0.08
324	0.07
325	0.07
326	0.06
327	0.05
328	0.04
329	0.03
330	0.03
331	0.02
332	0.02
333	0.02
334	0.02
335	0.02
336	0.02
337	0.02
338	0.02
339	0.02
340	0.03
341	0.04
342	0.04
343	0.04
344	0.04
345	0.05
346	0.05
347	0.05
348	0.06
349	0.05
350	0.05
351	0.05
352	0.05
353	0.05
354	0.05
355	0.05
356	0.05
357	0.05
358	0.07
359	0.08
360	0.1
361	0.13
362	0.13
363	0.14
364	0.16
365	0.24
366	0.27
367	0.28
368	0.28
369	0.28
370	0.28
371	0.28
372	0.27
373	0.19
374	0.14
375	0.14
376	0.15
377	0.19
378	0.19
379	0.19
380	0.18
381	0.18
382	0.2
383	0.18
384	0.15
385	0.08
386	0.08
387	0.08
388	0.09
389	0.09
390	0.06
391	0.06
392	0.06
393	0.08
394	0.08
395	0.07
396	0.06
397	0.06
398	0.07
399	0.07
400	0.07
401	0.07
402	0.09
403	0.1
404	0.11
405	0.14
406	0.15
407	0.16
408	0.16
409	0.15
410	0.13
411	0.13
412	0.13
413	0.09
414	0.08
415	0.06
416	0.06
417	0.06
418	0.06
419	0.06
420	0.05
421	0.06
422	0.08
423	0.1
424	0.12
425	0.13
426	0.13
427	0.19
428	0.23
429	0.3
430	0.33
431	0.32
432	0.33
433	0.36
434	0.36
435	0.33
436	0.37
437	0.34

A0A177EE13

3D AlphaFold-predicted Structure Viewer