Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EE13

Protein Details
Accession A0A177EE13   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDWKRICCRRKQEPEEGAAGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011356  Leucine_aapep/pepB  
IPR043472  Macro_dom-like  
IPR000819  Peptidase_M17_C  
IPR023042  Peptidase_M17_leu_NH2_pept  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0030145  F:manganese ion binding  
GO:0070006  F:metalloaminopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00883  Peptidase_M17  
PROSITE View protein in PROSITE  
PS00631  CYTOSOL_AP  
CDD cd00433  Peptidase_M17  
Amino Acid Sequences MDWKRICCRRKQEPEEGAAGGVVLYSDTIEAPAEIKACIATLPENEQSKWTIYLEKKTYIVCKLSAEKVACPVYVRKTAAKATQGLIQEGVRNIIIEDGYMAEWVAEAVVVGSYQYDVLHSKKKTQVNVIYGGSDAKVEKAIVSGEAQNFARFLVDTPANLMTPTLFTEYAKEYLPKEVEVKVYGKSELAKMKMNLLLGVSNGSAEEPKLLEIKYLKGDQTVALVGKGVTFDSGGISLKPSAKMALMKGDMAGGASVVATIGALARLSAKTSVIGIIPLTENLPSGTATKPGDVHVGAAGKSVEVDNTDAEGRLILGDALHHALSFNPAKIVDVATLTGAMSVALGAVMAGLFTNSDELGSELLSASACAADPIWRMPVTDDYKSLISSDVADIKNIGGPAGGSITAALFLKEFVGTTPWAHLDIAGVAGSTLTPELHGKGATGRPVKLLVHWLAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.65
4 0.54
5 0.42
6 0.33
7 0.22
8 0.14
9 0.09
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.06
18 0.07
19 0.08
20 0.09
21 0.09
22 0.09
23 0.08
24 0.08
25 0.08
26 0.09
27 0.1
28 0.12
29 0.17
30 0.23
31 0.27
32 0.27
33 0.29
34 0.29
35 0.29
36 0.29
37 0.25
38 0.28
39 0.29
40 0.38
41 0.41
42 0.42
43 0.41
44 0.42
45 0.46
46 0.43
47 0.42
48 0.34
49 0.35
50 0.37
51 0.38
52 0.41
53 0.38
54 0.34
55 0.37
56 0.37
57 0.32
58 0.3
59 0.31
60 0.3
61 0.35
62 0.37
63 0.34
64 0.37
65 0.41
66 0.44
67 0.43
68 0.4
69 0.35
70 0.37
71 0.35
72 0.32
73 0.28
74 0.24
75 0.22
76 0.2
77 0.19
78 0.14
79 0.13
80 0.12
81 0.11
82 0.1
83 0.07
84 0.07
85 0.06
86 0.07
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.04
93 0.03
94 0.02
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.05
104 0.08
105 0.11
106 0.19
107 0.2
108 0.27
109 0.34
110 0.4
111 0.43
112 0.49
113 0.53
114 0.49
115 0.54
116 0.48
117 0.4
118 0.35
119 0.32
120 0.23
121 0.17
122 0.13
123 0.08
124 0.08
125 0.08
126 0.07
127 0.08
128 0.08
129 0.08
130 0.09
131 0.12
132 0.12
133 0.15
134 0.15
135 0.14
136 0.14
137 0.13
138 0.12
139 0.09
140 0.09
141 0.11
142 0.11
143 0.11
144 0.13
145 0.14
146 0.13
147 0.13
148 0.12
149 0.08
150 0.08
151 0.09
152 0.09
153 0.09
154 0.09
155 0.11
156 0.13
157 0.14
158 0.15
159 0.15
160 0.14
161 0.18
162 0.18
163 0.17
164 0.17
165 0.18
166 0.18
167 0.19
168 0.19
169 0.17
170 0.17
171 0.17
172 0.15
173 0.15
174 0.17
175 0.18
176 0.19
177 0.21
178 0.2
179 0.23
180 0.24
181 0.23
182 0.19
183 0.15
184 0.14
185 0.1
186 0.1
187 0.07
188 0.05
189 0.05
190 0.05
191 0.05
192 0.04
193 0.05
194 0.04
195 0.05
196 0.07
197 0.07
198 0.08
199 0.09
200 0.11
201 0.14
202 0.15
203 0.14
204 0.14
205 0.14
206 0.12
207 0.13
208 0.12
209 0.09
210 0.07
211 0.07
212 0.07
213 0.06
214 0.06
215 0.05
216 0.04
217 0.04
218 0.04
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.07
225 0.08
226 0.09
227 0.09
228 0.09
229 0.1
230 0.11
231 0.11
232 0.14
233 0.13
234 0.13
235 0.12
236 0.12
237 0.11
238 0.09
239 0.08
240 0.04
241 0.03
242 0.03
243 0.02
244 0.02
245 0.02
246 0.02
247 0.02
248 0.02
249 0.02
250 0.02
251 0.02
252 0.04
253 0.04
254 0.05
255 0.06
256 0.06
257 0.06
258 0.07
259 0.07
260 0.06
261 0.07
262 0.06
263 0.06
264 0.07
265 0.07
266 0.07
267 0.06
268 0.06
269 0.06
270 0.07
271 0.06
272 0.08
273 0.08
274 0.11
275 0.12
276 0.13
277 0.13
278 0.13
279 0.15
280 0.13
281 0.13
282 0.12
283 0.13
284 0.11
285 0.12
286 0.11
287 0.08
288 0.09
289 0.08
290 0.06
291 0.06
292 0.07
293 0.06
294 0.08
295 0.08
296 0.08
297 0.08
298 0.07
299 0.07
300 0.06
301 0.05
302 0.04
303 0.04
304 0.04
305 0.05
306 0.06
307 0.06
308 0.06
309 0.06
310 0.06
311 0.11
312 0.13
313 0.12
314 0.12
315 0.12
316 0.13
317 0.14
318 0.14
319 0.1
320 0.09
321 0.09
322 0.08
323 0.08
324 0.07
325 0.07
326 0.06
327 0.05
328 0.04
329 0.03
330 0.03
331 0.02
332 0.02
333 0.02
334 0.02
335 0.02
336 0.02
337 0.02
338 0.02
339 0.02
340 0.03
341 0.04
342 0.04
343 0.04
344 0.04
345 0.05
346 0.05
347 0.05
348 0.06
349 0.05
350 0.05
351 0.05
352 0.05
353 0.05
354 0.05
355 0.05
356 0.05
357 0.05
358 0.07
359 0.08
360 0.1
361 0.13
362 0.13
363 0.14
364 0.16
365 0.24
366 0.27
367 0.28
368 0.28
369 0.28
370 0.28
371 0.28
372 0.27
373 0.19
374 0.14
375 0.14
376 0.15
377 0.19
378 0.19
379 0.19
380 0.18
381 0.18
382 0.2
383 0.18
384 0.15
385 0.08
386 0.08
387 0.08
388 0.09
389 0.09
390 0.06
391 0.06
392 0.06
393 0.08
394 0.08
395 0.07
396 0.06
397 0.06
398 0.07
399 0.07
400 0.07
401 0.07
402 0.09
403 0.1
404 0.11
405 0.14
406 0.15
407 0.16
408 0.16
409 0.15
410 0.13
411 0.13
412 0.13
413 0.09
414 0.08
415 0.06
416 0.06
417 0.06
418 0.06
419 0.06
420 0.05
421 0.06
422 0.08
423 0.1
424 0.12
425 0.13
426 0.13
427 0.19
428 0.23
429 0.3
430 0.33
431 0.32
432 0.33
433 0.36
434 0.36
435 0.33
436 0.37
437 0.34