Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YSG4

Protein Details
Accession G8YSG4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
97-118AERPTHQSRGPRRDDYRRRARDBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 14.333, mito_nucl 11.165, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037447  Rps10  
IPR005326  S10_plectin_N  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF03501  S10_plectin  
Amino Acid Sequences MLIPKEDRKKIHQYLFQEGVVVAKKDFNAPKHDEIDTKNLYVIKALQSLTSKGFVKTQFSWQYYYYTLTDEGVEYLRTELNIPEGILPLTRLKGAPAERPTHQSRGPRRDDYRRRARD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.58
4 0.49
5 0.39
6 0.34
7 0.3
8 0.25
9 0.17
10 0.14
11 0.15
12 0.2
13 0.25
14 0.25
15 0.29
16 0.34
17 0.39
18 0.4
19 0.41
20 0.38
21 0.36
22 0.4
23 0.35
24 0.3
25 0.27
26 0.24
27 0.23
28 0.2
29 0.19
30 0.13
31 0.14
32 0.14
33 0.14
34 0.14
35 0.16
36 0.16
37 0.18
38 0.17
39 0.14
40 0.18
41 0.17
42 0.2
43 0.2
44 0.27
45 0.29
46 0.3
47 0.32
48 0.29
49 0.3
50 0.27
51 0.28
52 0.2
53 0.16
54 0.15
55 0.13
56 0.12
57 0.1
58 0.1
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.16
81 0.19
82 0.26
83 0.3
84 0.33
85 0.35
86 0.42
87 0.46
88 0.46
89 0.48
90 0.5
91 0.55
92 0.6
93 0.66
94 0.68
95 0.72
96 0.77
97 0.83
98 0.84