Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EDW3

Protein Details
Accession A0A177EDW3   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-51IGSADKKKGKQHTQKGHYNFRSHydrophilic
NLS Segment(s)
PositionSequence
15-40KSAEKRPAGKAPSKGIGSADKKKGKQ
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MNKSIEGSKSAQGSKSAEKRPAGKAPSKGIGSADKKKGKQHTQKGHYNFRSSVKRMLKTTYQASPTQVSGPVVESLCNIVHDIIERVALECATLARKVGKQTINLEEVTSASQVNLTGELRSHALKEIKEAVAKVPAKSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.46
4 0.48
5 0.5
6 0.53
7 0.56
8 0.6
9 0.57
10 0.55
11 0.55
12 0.54
13 0.56
14 0.52
15 0.46
16 0.4
17 0.43
18 0.43
19 0.45
20 0.49
21 0.49
22 0.51
23 0.58
24 0.65
25 0.67
26 0.7
27 0.72
28 0.74
29 0.75
30 0.81
31 0.81
32 0.83
33 0.76
34 0.7
35 0.62
36 0.59
37 0.58
38 0.51
39 0.53
40 0.49
41 0.49
42 0.46
43 0.47
44 0.44
45 0.41
46 0.42
47 0.37
48 0.33
49 0.3
50 0.31
51 0.28
52 0.25
53 0.22
54 0.19
55 0.15
56 0.11
57 0.11
58 0.11
59 0.09
60 0.09
61 0.08
62 0.08
63 0.08
64 0.08
65 0.07
66 0.06
67 0.06
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.06
77 0.05
78 0.06
79 0.06
80 0.07
81 0.07
82 0.09
83 0.12
84 0.14
85 0.21
86 0.24
87 0.26
88 0.31
89 0.35
90 0.35
91 0.33
92 0.31
93 0.24
94 0.22
95 0.19
96 0.14
97 0.1
98 0.07
99 0.07
100 0.07
101 0.08
102 0.09
103 0.09
104 0.09
105 0.09
106 0.11
107 0.12
108 0.13
109 0.13
110 0.17
111 0.2
112 0.2
113 0.25
114 0.29
115 0.3
116 0.32
117 0.32
118 0.28
119 0.33
120 0.35
121 0.32