Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177EAJ0

Protein Details
Accession A0A177EAJ0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MARKKPQRAKRRVPPAPSKRFSCHydrophilic
NLS Segment(s)
PositionSequence
3-19RKKPQRAKRRVPPAPSK
Subcellular Location(s) mito 14.5, mito_nucl 12.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MARKKPQRAKRRVPPAPSKRFSCLECNRENVVTCTIDHNKGTGVARCLVCSVQFQCPTNKLSQAIDVYAEWVDKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.89
4 0.84
5 0.77
6 0.71
7 0.67
8 0.6
9 0.59
10 0.57
11 0.53
12 0.5
13 0.5
14 0.47
15 0.45
16 0.43
17 0.35
18 0.29
19 0.22
20 0.2
21 0.2
22 0.2
23 0.21
24 0.19
25 0.17
26 0.15
27 0.16
28 0.18
29 0.15
30 0.14
31 0.17
32 0.17
33 0.17
34 0.18
35 0.16
36 0.15
37 0.16
38 0.17
39 0.2
40 0.24
41 0.25
42 0.28
43 0.31
44 0.33
45 0.32
46 0.33
47 0.28
48 0.25
49 0.28
50 0.26
51 0.24
52 0.23
53 0.2
54 0.18
55 0.17
56 0.16