Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EEQ2

Protein Details
Accession A0A177EEQ2   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-94ANLLVRQKDKNEKKPKPEPVNPVNGNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MLQREEEEQRAVQAFEEAPAPQKQEQKTVRQLVKELEQSLDINHFLNTKFHRQNHGLCEKLIQERAKEANLLVRQKDKNEKKPKPEPVNPVNGNAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.14
4 0.11
5 0.13
6 0.15
7 0.18
8 0.2
9 0.26
10 0.27
11 0.35
12 0.4
13 0.44
14 0.52
15 0.57
16 0.56
17 0.51
18 0.52
19 0.45
20 0.46
21 0.41
22 0.33
23 0.25
24 0.23
25 0.21
26 0.19
27 0.18
28 0.13
29 0.1
30 0.09
31 0.1
32 0.09
33 0.12
34 0.14
35 0.21
36 0.26
37 0.28
38 0.33
39 0.35
40 0.39
41 0.44
42 0.48
43 0.41
44 0.35
45 0.35
46 0.32
47 0.32
48 0.33
49 0.27
50 0.21
51 0.24
52 0.26
53 0.25
54 0.23
55 0.2
56 0.22
57 0.27
58 0.3
59 0.28
60 0.34
61 0.36
62 0.41
63 0.52
64 0.54
65 0.59
66 0.66
67 0.73
68 0.75
69 0.83
70 0.88
71 0.87
72 0.86
73 0.85
74 0.82
75 0.84
76 0.76