Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EIX5

Protein Details
Accession A0A177EIX5   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-33KVTSVGSKMKSKKMRAKKGVDTMAKKHydrophilic
214-234LQNCHVKKVKVVKRPKVDDSQHydrophilic
NLS Segment(s)
PositionSequence
13-25GSKMKSKKMRAKK
Subcellular Location(s) mito 15.5, mito_nucl 11.833, nucl 7, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027500  Ribosomal_S1/3_euk  
IPR001593  Ribosomal_S3Ae  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01015  Ribosomal_S3Ae  
Amino Acid Sequences MASKGKAKVTSVGSKMKSKKMRAKKGVDTMAKKEFYNLTLPSSLAVRQAGVTVIDKSQGTYFAPDALKGRTFEVNQADLNTGANTQAFRKFKFVVDGVKGTDAISSFHGMELISDKIKSIPKKWHTLIEACLKIETVDGYTLRVFTVANTKRKPKAIKKNCYATQAQVKSIRKIIFKIIEEEIKDCTIHDIMKKLMSESIGTRIEQEGFKVYPLQNCHVKKVKVVKRPKVDDSQFDTKLKSKKIEMVTEVDVAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.64
4 0.66
5 0.67
6 0.72
7 0.75
8 0.82
9 0.83
10 0.86
11 0.85
12 0.86
13 0.86
14 0.84
15 0.79
16 0.74
17 0.73
18 0.65
19 0.56
20 0.5
21 0.42
22 0.35
23 0.35
24 0.3
25 0.25
26 0.25
27 0.25
28 0.21
29 0.21
30 0.19
31 0.16
32 0.15
33 0.11
34 0.1
35 0.11
36 0.11
37 0.11
38 0.12
39 0.11
40 0.11
41 0.12
42 0.12
43 0.13
44 0.13
45 0.13
46 0.12
47 0.13
48 0.13
49 0.16
50 0.16
51 0.16
52 0.18
53 0.19
54 0.2
55 0.19
56 0.21
57 0.2
58 0.2
59 0.24
60 0.26
61 0.25
62 0.23
63 0.23
64 0.22
65 0.18
66 0.18
67 0.13
68 0.1
69 0.08
70 0.08
71 0.08
72 0.09
73 0.16
74 0.17
75 0.18
76 0.22
77 0.23
78 0.24
79 0.27
80 0.27
81 0.26
82 0.27
83 0.27
84 0.24
85 0.23
86 0.22
87 0.18
88 0.17
89 0.11
90 0.09
91 0.09
92 0.09
93 0.08
94 0.08
95 0.08
96 0.07
97 0.07
98 0.08
99 0.08
100 0.07
101 0.07
102 0.08
103 0.1
104 0.15
105 0.17
106 0.19
107 0.27
108 0.31
109 0.39
110 0.4
111 0.42
112 0.41
113 0.41
114 0.41
115 0.39
116 0.36
117 0.28
118 0.27
119 0.22
120 0.19
121 0.17
122 0.13
123 0.06
124 0.06
125 0.06
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.16
134 0.21
135 0.28
136 0.31
137 0.37
138 0.41
139 0.47
140 0.56
141 0.56
142 0.62
143 0.65
144 0.72
145 0.74
146 0.8
147 0.78
148 0.74
149 0.65
150 0.59
151 0.58
152 0.5
153 0.46
154 0.45
155 0.44
156 0.41
157 0.45
158 0.44
159 0.36
160 0.35
161 0.37
162 0.35
163 0.34
164 0.35
165 0.32
166 0.32
167 0.31
168 0.3
169 0.26
170 0.2
171 0.19
172 0.15
173 0.15
174 0.13
175 0.14
176 0.15
177 0.16
178 0.17
179 0.2
180 0.2
181 0.19
182 0.19
183 0.18
184 0.18
185 0.16
186 0.21
187 0.2
188 0.19
189 0.2
190 0.2
191 0.21
192 0.2
193 0.19
194 0.17
195 0.16
196 0.17
197 0.2
198 0.21
199 0.24
200 0.28
201 0.32
202 0.37
203 0.39
204 0.46
205 0.49
206 0.49
207 0.51
208 0.58
209 0.61
210 0.62
211 0.71
212 0.73
213 0.75
214 0.81
215 0.8
216 0.8
217 0.76
218 0.75
219 0.73
220 0.72
221 0.66
222 0.6
223 0.57
224 0.53
225 0.55
226 0.53
227 0.5
228 0.45
229 0.49
230 0.54
231 0.58
232 0.55
233 0.53
234 0.5
235 0.46