Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EGZ9

Protein Details
Accession A0A177EGZ9   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
193-216VFSTYIPYKVRNRKGRKAKRDGEQHydrophilic
NLS Segment(s)
PositionSequence
203-212RNRKGRKAKR
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR003889  FYrich_C  
IPR003888  FYrich_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0043170  P:macromolecule metabolic process  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
Pfam View protein in Pfam  
PF05964  FYRN  
PROSITE View protein in PROSITE  
PS51543  FYRC  
PS51542  FYRN  
Amino Acid Sequences MAEANSSSSNAQLNEYISQYIEIRKRAEDKKKELQGLKNRRDALLDLLVYIKGQGCPTSSDLGVESVFPLVLGKAHSKFSITSVGMLPPEECFGFYNHSYIYPPGFKSRRKYNSSNRVEAKVLYYCQIRNVDGECIFEIRSSSGKVWSGKKEQAWSSFTSEFEKISFPSIESFFGLGHETVQKIIEELGDISVFSTYIPYKVRNRKGRKAKRDGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.16
5 0.17
6 0.17
7 0.22
8 0.25
9 0.26
10 0.27
11 0.31
12 0.39
13 0.47
14 0.56
15 0.59
16 0.62
17 0.69
18 0.74
19 0.78
20 0.77
21 0.77
22 0.77
23 0.78
24 0.78
25 0.75
26 0.69
27 0.61
28 0.56
29 0.48
30 0.42
31 0.36
32 0.29
33 0.21
34 0.21
35 0.2
36 0.17
37 0.16
38 0.12
39 0.08
40 0.09
41 0.09
42 0.09
43 0.12
44 0.15
45 0.16
46 0.15
47 0.14
48 0.14
49 0.15
50 0.14
51 0.11
52 0.09
53 0.07
54 0.07
55 0.06
56 0.05
57 0.04
58 0.05
59 0.06
60 0.09
61 0.11
62 0.12
63 0.13
64 0.14
65 0.14
66 0.15
67 0.19
68 0.16
69 0.16
70 0.16
71 0.17
72 0.16
73 0.16
74 0.14
75 0.08
76 0.09
77 0.07
78 0.07
79 0.07
80 0.08
81 0.11
82 0.11
83 0.12
84 0.11
85 0.12
86 0.12
87 0.12
88 0.13
89 0.11
90 0.12
91 0.19
92 0.23
93 0.27
94 0.32
95 0.41
96 0.48
97 0.52
98 0.6
99 0.62
100 0.69
101 0.71
102 0.73
103 0.65
104 0.59
105 0.53
106 0.46
107 0.38
108 0.29
109 0.23
110 0.18
111 0.17
112 0.15
113 0.18
114 0.2
115 0.17
116 0.17
117 0.18
118 0.19
119 0.17
120 0.18
121 0.14
122 0.13
123 0.13
124 0.12
125 0.11
126 0.08
127 0.09
128 0.1
129 0.1
130 0.12
131 0.16
132 0.2
133 0.25
134 0.3
135 0.34
136 0.37
137 0.39
138 0.42
139 0.42
140 0.43
141 0.41
142 0.38
143 0.38
144 0.35
145 0.33
146 0.32
147 0.28
148 0.23
149 0.21
150 0.2
151 0.15
152 0.17
153 0.16
154 0.13
155 0.16
156 0.16
157 0.17
158 0.16
159 0.16
160 0.12
161 0.13
162 0.14
163 0.11
164 0.11
165 0.12
166 0.11
167 0.11
168 0.12
169 0.12
170 0.1
171 0.11
172 0.09
173 0.08
174 0.08
175 0.09
176 0.08
177 0.08
178 0.08
179 0.07
180 0.07
181 0.06
182 0.08
183 0.08
184 0.12
185 0.15
186 0.2
187 0.3
188 0.41
189 0.52
190 0.6
191 0.69
192 0.76
193 0.85
194 0.9
195 0.91
196 0.92