Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177EDZ1

Protein Details
Accession A0A177EDZ1    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-34VEVPPKPLKKKEKGYNIRGDNHydrophilic
NLS Segment(s)
PositionSequence
23-23K
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MDEIDRLFKRSQAVEVPPKPLKKKEKGYNIRGDNIKVTEEYTEDGYRIYTEEELKIGRGGDSAACPLDCKCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.49
4 0.5
5 0.55
6 0.56
7 0.59
8 0.6
9 0.6
10 0.67
11 0.69
12 0.75
13 0.78
14 0.81
15 0.82
16 0.76
17 0.72
18 0.63
19 0.55
20 0.46
21 0.37
22 0.29
23 0.2
24 0.17
25 0.12
26 0.1
27 0.1
28 0.11
29 0.1
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.08
37 0.09
38 0.1
39 0.11
40 0.11
41 0.12
42 0.13
43 0.12
44 0.1
45 0.09
46 0.09
47 0.1
48 0.11
49 0.12
50 0.12
51 0.12
52 0.13
53 0.14