Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EI87

Protein Details
Accession A0A177EI87    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-26PSKACNSKKIVNRAIRRSCKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
Amino Acid Sequences MSRRTPSKACNSKKIVNRAIRRSCKLRNRTPDMDEIREKVDLQIDTPVDNPEHTRCIECNRVMEKVTMEKHLASRGHKKRLRDLREDALLEQDRKNGLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.75
4 0.77
5 0.77
6 0.8
7 0.81
8 0.79
9 0.77
10 0.77
11 0.77
12 0.78
13 0.77
14 0.76
15 0.77
16 0.76
17 0.71
18 0.71
19 0.66
20 0.62
21 0.54
22 0.46
23 0.39
24 0.34
25 0.3
26 0.22
27 0.21
28 0.15
29 0.13
30 0.15
31 0.14
32 0.13
33 0.14
34 0.14
35 0.1
36 0.11
37 0.12
38 0.1
39 0.12
40 0.12
41 0.12
42 0.12
43 0.17
44 0.22
45 0.22
46 0.26
47 0.26
48 0.28
49 0.27
50 0.28
51 0.25
52 0.25
53 0.26
54 0.23
55 0.22
56 0.21
57 0.22
58 0.26
59 0.28
60 0.28
61 0.37
62 0.43
63 0.52
64 0.55
65 0.58
66 0.62
67 0.7
68 0.72
69 0.69
70 0.67
71 0.64
72 0.68
73 0.65
74 0.55
75 0.53
76 0.51
77 0.45
78 0.4
79 0.36